SAXSdb — 8s0g

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Green fluorescent protein

Renilla reniformis

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Coelenterazine h 2-monooxygenase × 2 （P27652） water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Coelenterazine h 2-monooxygenase × 2 （P27652） water × 4	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Coelenterazine h 2-monooxygenase × 2 （P27652） N-[3-BENZYL-5-(4-HYDROXYPHENYL)PYRAZIN-2-YL]-2-(4-HYDROXYPHENYL)ACETAMIDE × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q963I9_RENRE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–231； UniProt 1–233 Author chain B； PDBConstruct 1–231； UniProt 1–233 Author chain E； PDBConstruct 1–231； UniProt 1–233 Author chain F； PDBConstruct 1–231； UniProt 1–233 Author chain I； PDBConstruct 1–231； UniProt 1–233 Author chain J； PDBConstruct 1–231； UniProt 1–233

Coelenterazine h 2-monooxygenase

Renilla reniformis

UniProt P27652

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Green fluorescent protein × 2 （Q963I9） water × 4	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 4	Green fluorescent protein × 2 （Q963I9） water × 4	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 4	Green fluorescent protein × 2 （Q963I9） N-[3-BENZYL-5-(4-HYDROXYPHENYL)PYRAZIN-2-YL]-2-(4-HYDROXYPHENYL)ACETAMIDE × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	LUCI_RENRE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–311； UniProt 1–311 Author chain D； PDBConstruct 1–311； UniProt 1–311 Author chain G； PDBConstruct 1–311； UniProt 1–311 Author chain H； PDBConstruct 1–311； UniProt 1–311 Author chain K； PDBConstruct 1–311； UniProt 1–311 Author chain L； PDBConstruct 1–311； UniProt 1–311

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8s0g
Deposition date deposition_date	2024-02-14
Last revision last_revision	2025-09-03
Structure title title	Crystal structure of Renilla reniformis luciferase-GFP BRET complex
Keywords keywords	;bioluminescence, luciferase, green fluorescent protein, BRET (bioluminescence resonance energy transfer) complex, coelenteramide emitter, HYDROLASE ;; HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8s0g__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8s0g__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8s0g__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	38.13 Å
Rg (electron density)	38.18 Å
Total Rg	38.40 Å
Atom count	8690
Residues	1074
Excluded volume	155510 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8s0g__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8s0g__assembly_2__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`8s0g__assembly_3__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Green fluorescent protein
Molecular weight formula_weight	26017.8 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,E,F,I,J
Atom count atom_count	26441

MDLAKLGLKEVMPTKINLEGLVGDHAFSMEGVGEGNILEGTQEVKISVTKGAPLPFAFDIVSVAFTYGNRAYTGYPEEISDYFLQSFPEGFTYERNIRYQDGGTAIVKSDISLEDGKFIVNVDFKAKDLRRMGPVMQQDIVGMQPSYESMYTNVTSVIGECIIAFKLQTGKHFTYHMRTVYKSKKPVETMPLYHFIQHRLVKTNVDTASGYVVQHETAIAAHSTIKKIEGSLP

Source Source

Source organism organism	Renilla reniformis
Common name common_name	sea pansy
NCBI taxonomy ID ncbi_taxonomy_id	6136
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Coelenterazine h 2-monooxygenase
Molecular weight formula_weight	36992.3 kDa
EC 编号 ec_number	1.13.12.5
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D,G,H,K,L

MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAKKFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQSGLEVLFQ

Source Source

Source organism organism	Renilla reniformis
Common name common_name	sea pansy
NCBI taxonomy ID ncbi_taxonomy_id	6136
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	N-[3-BENZYL-5-(4-HYDROXYPHENYL)PYRAZIN-2-YL]-2-(4-HYDROXYPHENYL)ACETAMIDE
Molecular weight formula_weight	411.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	371

▶

Unit-cell length a length_a	96.875 Å
Unit-cell length b length_b	96.875 Å
Unit-cell length c length_c	361.461 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	P 32
Space-group number int_tables_number	145
Crystal system crystal_system	—

Resolution resolution	2.378 Å
Low-resolution limit resolution_low	48.437 Å
R factor r_factor	0.2227
R_work r_work	0.2198
R_free r_free	0.2813

Crystal structure of Renilla reniformis luciferase-GFP BRET complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Green fluorescent protein

State in the Current Structure

Other States of the Same Protein in the Database

Coelenterazine h 2-monooxygenase

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8s0g__assembly_1__model_1

8s0g__assembly_1__model_1 | I(q)

8s0g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)

Crystal structure of Renilla reniformis luciferase-GFP BRET complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Green fluorescent protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Coelenterazine h 2-monooxygenase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8s0g__assembly_1__model_1

8s0g__assembly_1__model_1 | I(q)

8s0g__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Citations (1)