8sak

BtCoV-422 in complex with neutralizing antibody JC57-11

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Spike glycoprotein

unclassified Merbecovirus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 5 其他Polymer 16	JC57-11 Fab heavy chain × 1 JC57-11 Fab light chain × 1 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 12 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose × 3 ;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 1 2-acetamido-2-deoxy-beta-D-glucopyranose × 18	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A2R4KP93_MERS
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1289； UniProt 1–1289 Author chain B； PDBConstruct 1–1289； UniProt 1–1289 Author chain C； PDBConstruct 1–1289； UniProt 1–1289

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8sak
Deposition date deposition_date	2023-04-01
Structure title title	BtCoV-422 in complex with neutralizing antibody JC57-11
Keywords keywords	;coronavirus, MERS, neutralizing, antibody, MERS-like, merbecovirus, bat, virus, CDRH3, RBD, VIRAL PROTEIN, VIRAL PROTEIN-IMMUNE SYSTEM complex ;; VIRAL PROTEIN/IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8sak__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8sak__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8sak__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	51.50 Å
Rg (electron density)	51.26 Å
Total Rg	51.37 Å
Atom count	28520
Residues	3598
Excluded volume	506350 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8sak__assembly_1__model_1`	pentameric （5）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Spike glycoprotein
Molecular weight formula_weight	142101.1 kDa
Mutation mutation	A885P, A1056P, V1057P
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	28520

MRLSVCLLMFLLTPIKGDVDSGPPSSATSCKEADMRNSSSEFFNKQWPMPINASKADGIIYPTGKSYSNISLTLQGLFPKHGDLGEQYIYSVGHSDSNYDYLGKLFVSDYATKVVPFNNGFVVRIGAAANATGSVIISTVQKTIKKIYPAFMLGSSVGNFSNGVSGRYFNHTLLLLPDGCGTRLWALYCVIEPRNGSYCPGNSNYNTFAVFDTPHTDCTSAGYNTNATLNSFKEYFDLQNCSFIYSFNITEDENAEWFGITQNTQGVHLYSSRKGDLYGSNMFLFATLPVYDGIKYYTVIPRSIRSKYSERQAWAAFYIYSLHKLTYLLDFSVDGYIRRAVDCGHDDLSQLYCSYESFDVGSGVYSVSSFEVHSRGQFIEQPNSVECDFTKLLSGTPPQVYNFNRLVFTNCNYNLTKLLSLFMVNEFSCDGISPDAIARGCYSSLTVDYFAYPLSMKSYMQPGSAGVISQYNYKQSFANPTCRIFATAPANLTITKPSSYSFISKCSRLTGDNSHIETPIVINPGEYSICKNFAPNGFSQDGDYFTRQLSQLEGGGILVGVGSVTPMTDTLQMGFIISVQYGTDTNSVCPMMDLGNSTTITDKLGVCVEYNLYGVSGRGVFINCTAVGVKQQRFVYDGFDNLIGYYSDDGNYYCVRPCVSVPLSVVYDKTTNSHATIFGSVACEHITTMLHQFSRTTQASLRMRDVSNSGPLQTAVGCVIGLVNSSMVVDNCQLPLGQSLCAVPSTTRSSSQLQLATINYTQPQLLSPLNSSGFVVQVPTNFSFGITQEYIQTTIQKVTVDCKQYVCNGFQKCEQLLREYGQFCAKINQALHGANLMQDESVANLFSDIKTHKSQPLNAGLNGDFNLTLLQVPQVSTSQYSHRSPIEDLLFNKVTIADPGYMQGYDDCMKQGPPSARDLICAQYVAGYKVLPPLYDPNMEGAYTSSLLGSIAGAGWTAGLSSFAAIPFAQSIFYRMNGIGITQQVLSENQKLIANKFNQALGAMQTGFTTTNLAFSKVQDAVNANAQALSKLASELSNTFGAISSSISDILKRLDPPEQEAQIDRLINGRLTSLNAFVAQQLVRSETAARSAQLASDKVNECVKSQSKRNGFCGSGTHIVSFVINAPNGFYFFHVGYVPTNHVNVTAAYGLCNTDTPPRCIAPIDGYFVLNNTTTRDVVDQWYYTGSSFFNPEPITMANARYVSQDVKFENLTNQLPPPLLNNQTDLDFKEELEEFFKNVSSQGPNFQEISKINTTLLDLSTEMKVLNEVVKQLNESYIDLKELGNYSY

Source Source

Source organism organism	unclassified Merbecovirus
NCBI taxonomy ID ncbi_taxonomy_id	2664183
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	JC57-11 Fab heavy chain
Molecular weight formula_weight	25037.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

EVQLLESGPGVVRPSETLSLSCAVSGGSISDSYRWSWIRQPPGKGLEWVGYIFATGTTTNYNPSLKSRVTISKDTSKNQFSLKLSSVTAADTAVYYCAREPFKYCSGGVCYAHKDNSLDVWGQGVLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKG

Source Source

Source organism organism	Macaca
NCBI taxonomy ID ncbi_taxonomy_id	9539
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	JC57-11 Fab light chain
Molecular weight formula_weight	23264.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

VHSEIVMTQSPATLSLSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIHSASSRATGIPDRFSGSGSGTEFSLTISSLEAEDVGVYHCYQHSSGYTFGPGTKLDIKRTVAAPSVFIFPPSEDQVKSGTVSVVCLLNNFYPREASVKWKVDGALKTGNSQESVTEQDSKDNTYSLSSTLTLSSTEYQSHKVYACEVTHQGLSSPVTKSFNRGEC

Source Source

Source organism organism	Macaca
NCBI taxonomy ID ncbi_taxonomy_id	9539
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	12

Entity 5 Entity 5 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	570.5 kDa
Source method src_method	man
Copy count entity_count	3

Entity 6 Entity 6 branched

Description description	;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	910.8 kDa
Source method src_method	man
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	18

▶

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	57821

BtCoV-422 in complex with neutralizing antibody JC57-11

1. Protein Identity and Related Structures Protein Identity & Related Structures

Spike glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8sak__assembly_1__model_1

8sak__assembly_1__model_1 | I(q)

8sak__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 branched

Entity 5 Entity 5 branched

Entity 6 Entity 6 branched

Entity 7 Entity 7 non-polymer

7. Citations (1)

BtCoV-422 in complex with neutralizing antibody JC57-11

1. Protein Identity and Related Structures Protein Identity & Related Structures

Spike glycoprotein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8sak__assembly_1__model_1

8sak__assembly_1__model_1 | I(q)

8sak__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 branched

Entity 5 Entity 5 branched

Entity 6 Entity 6 branched

Entity 7 Entity 7 non-polymer

7. Citations (1)