8t1c

Cryo-EM structure of human TRPV4 ankyrin repeat domain in complex with GTPase RhoA

Method: ELECTRON MICROSCOPY D_max: 87.6 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transient receptor potential cation channel subfamily V member 4-Enhanced green fluorescent protein chimera

Human cytomegalovirus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 2–239	Not recorded	Transforming protein RhoA × 1 （P61586） GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.49 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8T1C	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7EEB Structure of the CatSpermasome Deposited 2021-03-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain A 1–239（239 aa）	Not recorded	NA SODIUM ION × 2 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 9	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen ETHANE；blot for 8 s before plunging	Resolution 2.90 Å
8T1B Cryo-EM structure of full-length human TRPV4 in apo state Deposited 2023-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 2–239（238 aa） Chain B 2–239（238 aa） Chain C 2–239（238 aa） Chain D 2–239（238 aa）	Not recorded	9ZR [(2~{R})-2-[(~{Z})-hexadec-9-enoyl]oxy-3-[oxidanyl-[2-(trimethyl-$l^{4}-azanyl)ethoxy]phosphoryl]oxy-propyl] (~{Z})-docos-13-enoate × 40 YJ0 (2R)-2-{[(4-O-hexopyranosyl-beta-D-glucopyranosyl)oxy]methyl}-4-{[(25R)-5beta,14beta,17beta-spirostan-3beta-yl]oxy}butyl 4-O-alpha-D-glucopyranosyl-beta-D-glucopyranoside × 8 NA SODIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8T1D Open-state cryo-EM structure of full-length human TRPV4 in complex with agonist 4a-PDD Deposited 2023-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 2–239（238 aa） Chain B 2–239（238 aa） Chain C 2–239（238 aa） Chain D 2–239（238 aa）	Not recorded	XS9 (1aR,1bS,4aS,7aS,7bS,8R,9R,9aS)-9a-(decanoyloxy)-4a,7b-dihydroxy-3-(hydroxymethyl)-1,1,6,8-tetramethyl-5-oxo-1a,1b,4,4a,5,7a,7b,8,9,9a-decahydro-1H-cyclopropa[3,4]benzo[1,2-e]azulen-9-yl decanoate × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.35 Å
8T1E Closed-state cryo-EM structure of full-length human TRPV4 in the presence of 4a-PDD Deposited 2023-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 2–239（238 aa） Chain B 2–239（238 aa） Chain C 2–239（238 aa） Chain D 2–239（238 aa）	Not recorded	9ZR [(2~{R})-2-[(~{Z})-hexadec-9-enoyl]oxy-3-[oxidanyl-[2-(trimethyl-$l^{4}-azanyl)ethoxy]phosphoryl]oxy-propyl] (~{Z})-docos-13-enoate × 32 YJ0 (2R)-2-{[(4-O-hexopyranosyl-beta-D-glucopyranosyl)oxy]methyl}-4-{[(25R)-5beta,14beta,17beta-spirostan-3beta-yl]oxy}butyl 4-O-alpha-D-glucopyranosyl-beta-D-glucopyranoside × 8 NA SODIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.77 Å
8T1F Cryo-EM structure of full-length human TRPV4 in complex with antagonist HC-067047 Deposited 2023-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 2–239（238 aa） Chain B 2–239（238 aa） Chain C 2–239（238 aa） Chain D 2–239（238 aa）	Not recorded	X7N 2-methyl-1-[3-(morpholin-4-yl)propyl]-5-phenyl-N-[3-(trifluoromethyl)phenyl]-1H-pyrrole-3-carboxamide × 4 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.49 Å

5 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	C5MKY7_HCMV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 882–1119； UniProt 2–239

Transient receptor potential cation channel subfamily V member 4-Enhanced green fluorescent protein chimera

Human cytomegalovirus

UniProt Q9HBA0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–871	Not recorded	Transforming protein RhoA × 1 （P61586） GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.49 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8T1C	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4DX1 Crystal structure of the human TRPV4 ankyrin repeat domain Deposited 2012-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 149–397（249 aa） Fragment：N-terminal domain (UNP residues 149-397)	Not recorded	PO4 PHOSPHATE ION × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.8；277 K；0.35M sodium potassium phosphate, 0.1M HEPES, 10% glycerol, pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.85 Å R-free 0.279
4DX1 Crystal structure of the human TRPV4 ankyrin repeat domain Deposited 2012-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 149–397（249 aa） Fragment：N-terminal domain (UNP residues 149-397)	Not recorded	PO4 PHOSPHATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.8；277 K；0.35M sodium potassium phosphate, 0.1M HEPES, 10% glycerol, pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.85 Å R-free 0.279
4DX2 Crystal structure of the human TRPV4 ankyrin repeat domain Deposited 2012-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 149–397（249 aa） Fragment：N-terminal domain (UNP residues 149-397)	Not recorded	BGC beta-D-glucopyranose × 1 ATP ADENOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.8；277 K；3.5% PEG4000, 0.1M HEPES, 10% glycerol, pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.95 Å R-free 0.220
4DX2 Crystal structure of the human TRPV4 ankyrin repeat domain Deposited 2012-02-27	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 149–397（249 aa） Fragment：N-terminal domain (UNP residues 149-397)	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.8；277 K；3.5% PEG4000, 0.1M HEPES, 10% glycerol, pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.95 Å R-free 0.220
7AA5 Human TRPV4 structure in presence of 4a-PDD Deposited 2020-09-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 148–787（640 aa） Chain B 148–787（640 aa） Chain C 148–787（640 aa） Chain D 148–787（640 aa）	Not recorded	CA CALCIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE；blot for 3 seconds before plunging	Resolution 4.18 Å
8FC7 Cryo-EM structure of the human TRPV4 - RhoA in complex with GSK2798745 Deposited 2022-12-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–871（871 aa） Chain B 1–871（871 aa） Chain C 1–871（871 aa） Chain D 1–871（871 aa）	Not recorded	XPW 1-({(5S,7S)-3-[5-(2-hydroxypropan-2-yl)pyrazin-2-yl]-7-methyl-2-oxo-1-oxa-3-azaspiro[4.5]decan-7-yl}methyl)-1H-benzimidazole-6-carbonitrile × 4 MG MAGNESIUM ION × 4 GDP GUANOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8FC8 Cryo-EM structure of the human TRPV4 in complex with GSK1016790A Deposited 2022-12-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–871（871 aa） Chain B 1–871（871 aa） Chain C 1–871（871 aa） Chain D 1–871（871 aa）	Not recorded	XQ3 N-[(2S)-1-{4-[N-(2,4-dichlorobenzene-1-sulfonyl)-L-seryl]piperazin-1-yl}-4-methyl-1-oxopentan-2-yl]-1-benzothiophene-2-carboxamide × 4 Y01 CHOLESTEROL HEMISUCCINATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.47 Å
8FC9 Cryo-EM structure of the human TRPV4 - RhoA, apo condition Deposited 2022-12-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–871（871 aa） Chain B 1–871（871 aa） Chain C 1–871（871 aa） Chain D 1–871（871 aa）	Not recorded	MG MAGNESIUM ION × 4 GDP GUANOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.75 Å
8FCA Cryo-EM structure of the human TRPV4 - RhoA in complex with 4alpha-Phorbol 12,13-didecanoate Deposited 2022-12-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–871（871 aa） Chain B 1–871（871 aa） Chain C 1–871（871 aa） Chain D 1–871（871 aa）	Not recorded	XS9 (1aR,1bS,4aS,7aS,7bS,8R,9R,9aS)-9a-(decanoyloxy)-4a,7b-dihydroxy-3-(hydroxymethyl)-1,1,6,8-tetramethyl-5-oxo-1a,1b,4,4a,5,7a,7b,8,9,9a-decahydro-1H-cyclopropa[3,4]benzo[1,2-e]azulen-9-yl decanoate × 4 Y01 CHOLESTEROL HEMISUCCINATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.41 Å
8FCB Cryo-EM structure of the human TRPV4 - RhoA in complex with GSK1016790A Deposited 2022-12-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–871（871 aa） Chain B 1–871（871 aa） Chain C 1–871（871 aa） Chain D 1–871（871 aa）	Not recorded	XQ3 N-[(2S)-1-{4-[N-(2,4-dichlorobenzene-1-sulfonyl)-L-seryl]piperazin-1-yl}-4-methyl-1-oxopentan-2-yl]-1-benzothiophene-2-carboxamide × 4 Y01 CHOLESTEROL HEMISUCCINATE × 4 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.52 Å
8JU5 Structure of human TRPV4 with antagonist A1 Deposited 2023-06-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–871（871 aa） Chain B 1–871（871 aa） Chain C 1–871（871 aa） Chain D 1–871（871 aa）	Not recorded	F3L 4-[(3~{S},4~{S})-4-(aminomethyl)-1-(5-chloranylpyridin-2-yl)sulfonyl-4-oxidanyl-pyrrolidin-3-yl]oxy-2-fluoranyl-benzenecarbonitrile × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.74 Å
8JU6 Structure of human TRPV4 with antagonist GSK279 Deposited 2023-06-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–871（871 aa） Chain B 1–871（871 aa） Chain C 1–871（871 aa） Chain D 1–871（871 aa）	Not recorded	XPW 1-({(5S,7S)-3-[5-(2-hydroxypropan-2-yl)pyrazin-2-yl]-7-methyl-2-oxo-1-oxa-3-azaspiro[4.5]decan-7-yl}methyl)-1H-benzimidazole-6-carbonitrile × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.45 Å
8JVI Structure of human TRPV4 with antagonist A2 Deposited 2023-06-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–871（871 aa） Chain B 1–871（871 aa） Chain C 1–871（871 aa） Chain D 1–871（871 aa）	Not recorded	F9M [6-[[4-(2,4-dimethyl-1,3-thiazol-5-yl)-1,3-thiazol-2-yl]amino]pyridin-3-yl]-[(1~{S},5~{R})-3-[5-(trifluoromethyl)pyrimidin-2-yl]-3,8-diazabicyclo[3.2.1]octan-8-yl]methanone × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.21 Å
8JVJ Structure of human TRPV4 with antagonist A2 and RhoA Deposited 2023-06-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–871（871 aa） Chain B 1–871（871 aa） Chain C 1–871（871 aa） Chain D 1–871（871 aa）	Not recorded	F9M [6-[[4-(2,4-dimethyl-1,3-thiazol-5-yl)-1,3-thiazol-2-yl]amino]pyridin-3-yl]-[(1~{S},5~{R})-3-[5-(trifluoromethyl)pyrimidin-2-yl]-3,8-diazabicyclo[3.2.1]octan-8-yl]methanone × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
8T1B Cryo-EM structure of full-length human TRPV4 in apo state Deposited 2023-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–871（871 aa） Chain B 1–871（871 aa） Chain C 1–871（871 aa） Chain D 1–871（871 aa）	Not recorded	9ZR [(2~{R})-2-[(~{Z})-hexadec-9-enoyl]oxy-3-[oxidanyl-[2-(trimethyl-$l^{4}-azanyl)ethoxy]phosphoryl]oxy-propyl] (~{Z})-docos-13-enoate × 40 YJ0 (2R)-2-{[(4-O-hexopyranosyl-beta-D-glucopyranosyl)oxy]methyl}-4-{[(25R)-5beta,14beta,17beta-spirostan-3beta-yl]oxy}butyl 4-O-alpha-D-glucopyranosyl-beta-D-glucopyranoside × 8 NA SODIUM ION × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8T1D Open-state cryo-EM structure of full-length human TRPV4 in complex with agonist 4a-PDD Deposited 2023-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–871（871 aa） Chain B 1–871（871 aa） Chain C 1–871（871 aa） Chain D 1–871（871 aa）	Not recorded	XS9 (1aR,1bS,4aS,7aS,7bS,8R,9R,9aS)-9a-(decanoyloxy)-4a,7b-dihydroxy-3-(hydroxymethyl)-1,1,6,8-tetramethyl-5-oxo-1a,1b,4,4a,5,7a,7b,8,9,9a-decahydro-1H-cyclopropa[3,4]benzo[1,2-e]azulen-9-yl decanoate × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.35 Å
8T1E Closed-state cryo-EM structure of full-length human TRPV4 in the presence of 4a-PDD Deposited 2023-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–871（871 aa） Chain B 1–871（871 aa） Chain C 1–871（871 aa） Chain D 1–871（871 aa）	Not recorded	9ZR [(2~{R})-2-[(~{Z})-hexadec-9-enoyl]oxy-3-[oxidanyl-[2-(trimethyl-$l^{4}-azanyl)ethoxy]phosphoryl]oxy-propyl] (~{Z})-docos-13-enoate × 32 YJ0 (2R)-2-{[(4-O-hexopyranosyl-beta-D-glucopyranosyl)oxy]methyl}-4-{[(25R)-5beta,14beta,17beta-spirostan-3beta-yl]oxy}butyl 4-O-alpha-D-glucopyranosyl-beta-D-glucopyranoside × 8 NA SODIUM ION × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.77 Å
8T1F Cryo-EM structure of full-length human TRPV4 in complex with antagonist HC-067047 Deposited 2023-06-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion	Assembly 1 Insufficient information Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 1–871（871 aa） Chain B 1–871（871 aa） Chain C 1–871（871 aa） Chain D 1–871（871 aa）	Not recorded	X7N 2-methyl-1-[3-(morpholin-4-yl)propyl]-5-phenyl-N-[3-(trifluoromethyl)phenyl]-1H-pyrrole-3-carboxamide × 4 POV (2S)-3-(hexadecanoyloxy)-2-[(9Z)-octadec-9-enoyloxy]propyl 2-(trimethylammonio)ethyl phosphate × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.49 Å
9IQX Cryo-EM structure of the human TRPV4-RhoA in complex with AH001 Deposited 2024-07-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 148–787（640 aa） Chain B 148–787（640 aa） Chain C 148–787（640 aa） Chain D 148–787（640 aa）	Not recorded	P5S O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine × 2 U6L (1~{R})-1-(3-ethylphenyl)ethane-1,2-diol × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.37 Å
9IQY Cryo-EM structure of human TRPV4 intracellular domain in complex with GTPase RhoA Deposited 2024-07-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 148–787（640 aa） Chain C 148–787（640 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å

18 other PDB entries and 20 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TRPV4_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–871； UniProt 1–871

Transforming protein RhoA

Homo sapiens

UniProt P61586

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Insufficient information Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain E； UniProt 1–193	Not recorded	Transient receptor potential cation channel subfamily V member 4-Enhanced green fluorescent protein chimera × 1 （Q9HBA0,C5MKY7） GDP GUANOSINE-5'-DIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer：pH 8 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.49 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8T1C	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1A2B HUMAN RHOA COMPLEXED WITH GTP ANALOGUE Deposited 1997-12-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa） Fragment：RESIDUES 1 - 181	Mutation：G14V, RESIDUES 1 - 181 WERE CLONED, THE N-TERMINUS CONTAINS A HIS-TAG	MG MAGNESIUM ION × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；277 K；CRYSTALS WERE OBTAINED AT 277 K BY THE HANGING-DROP VAPOR DIFFUSION METHOD FROM SOLUTIONS CONTAINING 10 MG/ML(PROTEIN,GTPGAMMAS,MG2+ MIXTURE), 10% PEG 8000,7.5% 14-DIOXANE, 50 MM TRIS-HCL PH 8.5, EQUILIBRATED AGAINST 20% PEG 8000,15% 14-DIOXANE, 100 MM TRIS-HCL PH 8.5, vapor diffusion - hanging drop	Resolution 2.40 Å R-free 0.268
1CC0 CRYSTAL STRUCTURE OF THE RHOA.GDP-RHOGDI COMPLEX Deposited 1999-03-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–190（190 aa）	Not recorded	MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.3；293 K；CRYSTALS GROWN BY VAPOR DIFFUSION IN A SITTING DROP USING EQUAL VOLUMES OF PROTEIN AND RESERVOIR. CRYSTALLIZATION OCCURED OVER A PERIOD OF SEVERAL DAYS AT 20 DEGREE CELSIUS. PROTEIN (15 MG/ML) WAS IN 25MM TRIS-HCL, PH=8.0, 100MM NACL, 5MM MGCL2. RESERVOIR CONTAINED: 51% SATURATED AMMONIUM SULFATE, 100 MM SODIUM ACETATE, PH=5.3, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 5.00 Å
1CC0 CRYSTAL STRUCTURE OF THE RHOA.GDP-RHOGDI COMPLEX Deposited 1999-03-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–190（190 aa）	Not recorded	MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.3；293 K；CRYSTALS GROWN BY VAPOR DIFFUSION IN A SITTING DROP USING EQUAL VOLUMES OF PROTEIN AND RESERVOIR. CRYSTALLIZATION OCCURED OVER A PERIOD OF SEVERAL DAYS AT 20 DEGREE CELSIUS. PROTEIN (15 MG/ML) WAS IN 25MM TRIS-HCL, PH=8.0, 100MM NACL, 5MM MGCL2. RESERVOIR CONTAINED: 51% SATURATED AMMONIUM SULFATE, 100 MM SODIUM ACETATE, PH=5.3, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 5.00 Å
1CXZ CRYSTAL STRUCTURE OF HUMAN RHOA COMPLEXED WITH THE EFFECTOR DOMAIN OF THE PROTEIN KINASE PKN/PRK1 Deposited 1999-08-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–181（181 aa） Fragment：RESIDUES 1 - 181	Mutation：G14V	MG MAGNESIUM ION × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 6.5；277 K；PEG 300, pH 6.5, MICROBATCH, temperature 277K	Resolution 2.20 Å R-free 0.268
1DPF CRYSTAL STRUCTURE OF A MG-FREE FORM OF RHOA COMPLEXED WITH GDP Deposited 1999-12-27	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–180（180 aa）	Mutation：G14V	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；PEG400, citrate, Lithium sulfate, magnesium chloride,, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.252
1FTN CRYSTAL STRUCTURE OF THE HUMAN RHOA/GDP COMPLEX Deposited 1997-03-13	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–193（193 aa）	Mutation：F25N	MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.5；pH 7.5	Resolution 2.10 Å R-free 0.304
1KMQ Crystal Structure of a Constitutively Activated RhoA Mutant (Q63L) Deposited 2001-12-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 4–181（178 aa）	Mutation：Q63L, F25N	MG MAGNESIUM ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 DIO 1,4-DIETHYLENE DIOXIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.9；282 K；PEG 8000, HEPES, dioxane, magnesium chloride, 2-mercaptoethanol, pH 6.9, VAPOR DIFFUSION, temperature 282K	Resolution 1.55 Å R-free 0.190
1LB1 Crystal Structure of the Dbl and Pleckstrin homology domains of Dbs in complex with RhoA Deposited 2002-04-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–190（190 aa） Fragment：residues 1-190	Mutation：C190S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.4；292 K；PEG 3350, lithium citrate, Inositol 1,4,5-trisphosphate, pH 8.4, VAPOR DIFFUSION, SITTING DROP, temperature 292K	Resolution 2.81 Å R-free 0.266
1LB1 Crystal Structure of the Dbl and Pleckstrin homology domains of Dbs in complex with RhoA Deposited 2002-04-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–190（190 aa） Fragment：residues 1-190	Mutation：C190S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.4；292 K；PEG 3350, lithium citrate, Inositol 1,4,5-trisphosphate, pH 8.4, VAPOR DIFFUSION, SITTING DROP, temperature 292K	Resolution 2.81 Å R-free 0.266
1LB1 Crystal Structure of the Dbl and Pleckstrin homology domains of Dbs in complex with RhoA Deposited 2002-04-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–190（190 aa） Fragment：residues 1-190	Mutation：C190S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.4；292 K；PEG 3350, lithium citrate, Inositol 1,4,5-trisphosphate, pH 8.4, VAPOR DIFFUSION, SITTING DROP, temperature 292K	Resolution 2.81 Å R-free 0.266
1LB1 Crystal Structure of the Dbl and Pleckstrin homology domains of Dbs in complex with RhoA Deposited 2002-04-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–190（190 aa） Fragment：residues 1-190	Mutation：C190S	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.4；292 K；PEG 3350, lithium citrate, Inositol 1,4,5-trisphosphate, pH 8.4, VAPOR DIFFUSION, SITTING DROP, temperature 292K	Resolution 2.81 Å R-free 0.266
1OW3 Crystal Structure of RhoA.GDP.MgF3-in Complex with RhoGAP Deposited 2003-03-28	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–193（193 aa）	Not recorded	MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 MGF TRIFLUOROMAGNESATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；291 K；18% PEG2KMME, 100mM MES, 10mM MgCl2, 10mM NaF, 2mM deferoxamine, 114mM (NH4)2SO4, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.80 Å R-free 0.219
1S1C Crystal structure of the complex between the human RhoA and Rho-binding domain of human ROCKI Deposited 2004-01-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–181（181 aa） Fragment：RhoA Chain B 1–181（181 aa） Fragment：RhoA	Not recorded	MG MAGNESIUM ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；pH 7.5；293 K；TRIS, PEG 3350, isopropyl alcohol, pH 7.5, EVAPORATION, temperature 293K	Resolution 2.60 Å R-free 0.257
1TX4 RHO/RHOGAP/GDP(DOT)ALF4 COMPLEX Deposited 1997-07-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 3–179（177 aa）	Not recorded	MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；PROTEIN WAS CRYSTALLIZED FROM 18% PEG 2000 MME 100MM MES PH6.0 10MM MGCL2, 3MM DTT, 3MM NAN3, 114MM AMMONIUM SULFATE 400UM PROTEIN COMPLEX WITH 1MM ALCL3 AND 10MM NAF.	Resolution 1.65 Å R-free 0.215
1X86 Crystal Structure of the DH/PH domains of Leukemia-associated RhoGEF in complex with RhoA Deposited 2004-08-17	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–193（193 aa）	Not recorded	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；277 K；PEG8K, sodium phosphate, sodium chloride, EDTA, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.22 Å R-free 0.279
1X86 Crystal Structure of the DH/PH domains of Leukemia-associated RhoGEF in complex with RhoA Deposited 2004-08-17	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–193（193 aa）	Not recorded	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；277 K；PEG8K, sodium phosphate, sodium chloride, EDTA, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.22 Å R-free 0.279
1X86 Crystal Structure of the DH/PH domains of Leukemia-associated RhoGEF in complex with RhoA Deposited 2004-08-17	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–193（193 aa）	Not recorded	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；277 K；PEG8K, sodium phosphate, sodium chloride, EDTA, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.22 Å R-free 0.279
1X86 Crystal Structure of the DH/PH domains of Leukemia-associated RhoGEF in complex with RhoA Deposited 2004-08-17	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–193（193 aa）	Not recorded	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；277 K；PEG8K, sodium phosphate, sodium chloride, EDTA, pH 7.4, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.22 Å R-free 0.279
1XCG Crystal Structure of Human RhoA in complex with DH/PH fragment of PDZRHOGEF Deposited 2004-09-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 3–180（178 aa） Fragment：RhoA	Mutation：F25N	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.2；298 K；PEG, Hepes, pH 7.2, VAPOR DIFFUSION, temperature 298K	Resolution 2.50 Å R-free 0.281
1XCG Crystal Structure of Human RhoA in complex with DH/PH fragment of PDZRHOGEF Deposited 2004-09-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 3–180（178 aa） Fragment：RhoA	Mutation：F25N	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.2；298 K；PEG, Hepes, pH 7.2, VAPOR DIFFUSION, temperature 298K	Resolution 2.50 Å R-free 0.281
2RGN Crystal Structure of p63RhoGEF complex with Galpha-q and RhoA Deposited 2007-10-04	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–193（193 aa）	Not recorded	ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM HEPES pH 6.5, 14.5% PEG 3350, 400 mM KCl. Drops were microseeded to obtain large crystals, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.50 Å R-free 0.299
2RGN Crystal Structure of p63RhoGEF complex with Galpha-q and RhoA Deposited 2007-10-04	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 1–193（193 aa）	Not recorded	ALF TETRAFLUOROALUMINATE ION × 1 MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；100 mM HEPES pH 6.5, 14.5% PEG 3350, 400 mM KCl. Drops were microseeded to obtain large crystals, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.50 Å R-free 0.299
3KZ1 Crystal Structure of the Complex of PDZ-RhoGEF DH/PH domains with GTP-gamma-S Activated RhoA Deposited 2009-12-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–181（181 aa） Fragment：UNP residues 1-181	Not recorded	MG MAGNESIUM ION × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；14-16% PEG 10000, 0.1M ammonium acetate, 0.1M Bis-Tris, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.70 Å R-free 0.283
3KZ1 Crystal Structure of the Complex of PDZ-RhoGEF DH/PH domains with GTP-gamma-S Activated RhoA Deposited 2009-12-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1–181（181 aa） Fragment：UNP residues 1-181	Not recorded	MG MAGNESIUM ION × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；14-16% PEG 10000, 0.1M ammonium acetate, 0.1M Bis-Tris, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.70 Å R-free 0.283
3LW8 Shigella IpgB2 in complex with human RhoA, GDP and Mg2+ (complex A) Deposited 2010-02-23	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–181（180 aa） Fragment：residues 2-181	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；20% (w/v) PEG 3350, pH 7.5, vapor diffusion, hanging drop, temperature 277K	Resolution 1.85 Å R-free 0.233
3LW8 Shigella IpgB2 in complex with human RhoA, GDP and Mg2+ (complex A) Deposited 2010-02-23	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–181（180 aa） Fragment：residues 2-181	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；20% (w/v) PEG 3350, pH 7.5, vapor diffusion, hanging drop, temperature 277K	Resolution 1.85 Å R-free 0.233
3LW8 Shigella IpgB2 in complex with human RhoA, GDP and Mg2+ (complex A) Deposited 2010-02-23	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 2–181（180 aa） Fragment：residues 2-181	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；20% (w/v) PEG 3350, pH 7.5, vapor diffusion, hanging drop, temperature 277K	Resolution 1.85 Å R-free 0.233
3LW8 Shigella IpgB2 in complex with human RhoA, GDP and Mg2+ (complex A) Deposited 2010-02-23	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 2–181（180 aa） Fragment：residues 2-181	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；20% (w/v) PEG 3350, pH 7.5, vapor diffusion, hanging drop, temperature 277K	Resolution 1.85 Å R-free 0.233
3LWN Shigella IpgB2 in complex with human RhoA, GDP and Mg2+ (complex B) Deposited 2010-02-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–181（180 aa） Fragment：residues 2-181	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；20% (w/v) PEG 3350; protein was treated with EDTA prior to crystallization, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.28 Å R-free 0.291
3LWN Shigella IpgB2 in complex with human RhoA, GDP and Mg2+ (complex B) Deposited 2010-02-24	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–181（180 aa） Fragment：residues 2-181	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；20% (w/v) PEG 3350; protein was treated with EDTA prior to crystallization, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.28 Å R-free 0.291
3LXR Shigella IpgB2 in complex with human RhoA and GDP (complex C) Deposited 2010-02-25	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–181（180 aa） Fragment：residues 2-181	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；20% (w/v) PEG 3350; post-crystallization treatment: EDTA, LiSO4, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.68 Å R-free 0.219
3MSX Crystal structure of RhoA.GDP.MgF3 in complex with GAP domain of ArhGAP20 Deposited 2010-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–180（180 aa）	Mutation：F25N	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 MGF TRIFLUOROMAGNESATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；Crystallization drop was 1:1 mixture of protein dissolved in 20 mM Tris, pH 8.5, 100 mM NaCl, 5 mM NaF, 5 mM MgCl2, 5mM 2-mercaptoethanol and 20 w/v% PEG 8000, 0.2 M NaCl, 0.17 M NH4Cl, 0.1 M phosphate citrate buffer. The crystallization reservoir was 20 w/v% PEG 8000, 0.2 M NaCl, 0.17 M NH4Cl, 0.1 M phosphate citrate buffer, vapor diffusion, sitting drop, temperature 293K	Resolution 1.65 Å R-free 0.219
3T06 Crystal Structure of the DH/PH fragment of PDZRHOGEF with N-terminal regulatory elements in complex with Human RhoA Deposited 2011-07-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 3–180（178 aa）	Mutation：F25N	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.15 M DL-malic acid, 20 % w/v PEG 3350, pH 7.0, vapor diffusion, sitting drop, temperature 298K	Resolution 2.84 Å R-free 0.257
3T06 Crystal Structure of the DH/PH fragment of PDZRHOGEF with N-terminal regulatory elements in complex with Human RhoA Deposited 2011-07-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 3–180（178 aa）	Mutation：F25N	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；0.15 M DL-malic acid, 20 % w/v PEG 3350, pH 7.0, vapor diffusion, sitting drop, temperature 298K	Resolution 2.84 Å R-free 0.257
4D0N AKAP13 (AKAP-Lbc) RhoGEF domain in complex with RhoA Deposited 2014-04-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa） Fragment：RESIDUES 1-184	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 5 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；0.2 M AMMONIUM SULPHATE, 0.1 M BIS-TRIS PH 5.5, 25% (W/V) PEG 3350	Resolution 2.10 Å R-free 0.239
4XH9 CRYSTAL STRUCTURE OF HUMAN RHOA IN COMPLEX WITH DH/PH FRAGMENT OF THE GUANINE NUCLEOTIDE EXCHANGE FACTOR NET1 Deposited 2015-01-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–180（179 aa） Fragment：UNP residues 2-180	Mutation：F25N	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M bisTris propane pH7.5, 20% PEG3350, 0.2M Tripotassium phosphate	Resolution 2.00 Å R-free 0.217
4XH9 CRYSTAL STRUCTURE OF HUMAN RHOA IN COMPLEX WITH DH/PH FRAGMENT OF THE GUANINE NUCLEOTIDE EXCHANGE FACTOR NET1 Deposited 2015-01-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 2–180（179 aa） Fragment：UNP residues 2-180	Mutation：F25N	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；0.1M bisTris propane pH7.5, 20% PEG3350, 0.2M Tripotassium phosphate	Resolution 2.00 Å R-free 0.217
4XOI Structure of hsAnillin bound with RhoA(Q63L) at 2.1 Angstroms resolution Deposited 2015-01-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–180（180 aa） Fragment：UNP residues 1-180	Mutation：Q63L	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；12% PEG 3,350, 3% PEG 10000, 0.2 M sodium malonate, 5 mM DTT	Resolution 2.09 Å R-free 0.206
4XOI Structure of hsAnillin bound with RhoA(Q63L) at 2.1 Angstroms resolution Deposited 2015-01-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–180（180 aa） Fragment：UNP residues 1-180	Mutation：Q63L	GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291 K；12% PEG 3,350, 3% PEG 10000, 0.2 M sodium malonate, 5 mM DTT	Resolution 2.09 Å R-free 0.206
4XSG The complex structure of C3cer exoenzyme and GTP bound RhoA (NADH-free state) Deposited 2015-01-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–179（179 aa） Fragment：UNP residues 1-179	Mutation：F25N	GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 1 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；100 mM MES (pH 6.4), 20% PEG1500	Resolution 1.80 Å R-free 0.223
4XSH The complex structure of C3cer exoenzyme and GTP bound RhoA (NADH-bound state) Deposited 2015-01-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–179（179 aa） Fragment：UNP residues 1-179	Mutation：F25N	GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 1 NAI 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 EDO 1,2-ETHANEDIOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；100 mM MES (pH 6.4), 20% PEG1500	Resolution 2.50 Å R-free 0.254
5A0F Crystal structure of Yersinia Afp18-modified RhoA Deposited 2015-04-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa） Fragment：RESIDUES 1-181	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 1 NDG 2-acetamido-2-deoxy-alpha-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293.15 K；0.1 M SODIUM ACETATE, PH 5 AND 1.5 M AMMONIUM SULFATE; SITTING-DROP VAPOR-DIFFUSION AT 293.15 K	Resolution 2.00 Å R-free 0.213
5BWM The complex structure of C3cer exoenzyme and GDP bound RhoA (NADH-bound state) Deposited 2015-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–179（179 aa） Fragment：UNP residues 1-179	Mutation：F25N	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 NAI 1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE × 1 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；100 mM MES (pH 6.4), 20% PEG1500	Resolution 2.50 Å R-free 0.246
5C2K Crystal structure of the fusion protein linked by RhoA and the GAP domain of MgcRacGAP Deposited 2015-06-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–193（193 aa） Fragment：GAP domain, UNP residues 346-546	Mutation：S249D	MG MAGNESIUM ION × 1 AF3 ALUMINUM FLUORIDE × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；PEG3350, Bis-Tris	Resolution 1.42 Å R-free 0.206
5C4M RhoA GDP with novel switch II conformation Deposited 2015-06-18	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–193（193 aa）	Mutation：F25N	MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；24% (w/v) PEG 3350, 0.3 NaCl	Resolution 1.30 Å R-free 0.200
5EZ6 Crystallization and preliminary X-ray crystallographic analysis of a small GTPase RhoA Deposited 2015-11-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–181（181 aa） Fragment：UNP RESIDUES 1-181	Not recorded	MG MAGNESIUM ION × 3 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M Ammonium citrate dibasic, 20% w/v Polyethylene glycol 3350	Resolution 1.80 Å R-free 0.213
5FR1 Double acetylated RhoGDI-alpha in complex with RhoA-GDP Deposited 2015-12-15	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–193（193 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.5；4 M SODIUM FORMATE, 0.1 M SODIUM ACETATE PH 4.5	Resolution 2.75 Å R-free 0.256
5FR2 Farnesylated RhoA-GDP in complex with RhoGDI-alpha, lysine acetylated at K178 Deposited 2015-12-15	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–193（193 aa）	Not recorded	FAR FARNESYL × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 BGC beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions 0.2 M LITHIUMSULFATE 0.1 M BIS-TRIS PH5.5 25% PEG3350 30% DEXTROSE	Resolution 3.35 Å R-free 0.258
5HPY Crystal Structure of RhoA.GDP.MgF3-in complex with human Myosin 9b RhoGAP domain Deposited 2016-01-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 3–181（179 aa） Fragment：UNP residues 3-181	Mutation：F25N	MGF TRIFLUOROMAGNESATE × 1 MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；289 K；20% (w/v) PEG 3350, 0.2M sodium malonate pH 7.0.	Resolution 2.40 Å R-free 0.246
5HPY Crystal Structure of RhoA.GDP.MgF3-in complex with human Myosin 9b RhoGAP domain Deposited 2016-01-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 3–181（179 aa） Fragment：UNP residues 3-181	Mutation：F25N	MGF TRIFLUOROMAGNESATE × 1 MG MAGNESIUM ION × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；289 K；20% (w/v) PEG 3350, 0.2M sodium malonate pH 7.0.	Resolution 2.40 Å R-free 0.246
5IRC p190A GAP domain complex with RhoA Deposited 2016-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 2–181（180 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 MGF TRIFLUOROMAGNESATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；294 K；30% PEG 2000MME 150mM KCSN 100mM MES, pH 6.5	Resolution 1.72 Å R-free 0.213
5IRC p190A GAP domain complex with RhoA Deposited 2016-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 2–181（180 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 MGF TRIFLUOROMAGNESATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；294 K；30% PEG 2000MME 150mM KCSN 100mM MES, pH 6.5	Resolution 1.72 Å R-free 0.213
5IRC p190A GAP domain complex with RhoA Deposited 2016-03-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 2–181（180 aa） Chain F 2–181（180 aa）	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 3 GDP GUANOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2 MGF TRIFLUOROMAGNESATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 6.5；294 K；30% PEG 2000MME 150mM KCSN 100mM MES, pH 6.5	Resolution 1.72 Å R-free 0.213
5JCP RhoGAP domain of ARAP3 in complex with RhoA in the transition state Deposited 2016-04-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 2–181（180 aa） Fragment：UNP residues 906-1107,UNP residues 2-181	Mutation：F25N	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；100 mM MES, 15%(v/v) PEG 550 MME, 4%(v/v) Acetone	Resolution 2.10 Å R-free 0.227
5JCP RhoGAP domain of ARAP3 in complex with RhoA in the transition state Deposited 2016-04-15	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 2–181（180 aa） Fragment：UNP residues 906-1107,UNP residues 2-181	Mutation：F25N	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 ALF TETRAFLUOROALUMINATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；100 mM MES, 15%(v/v) PEG 550 MME, 4%(v/v) Acetone	Resolution 2.10 Å R-free 0.227
5JHG Crystal structure of the complex between the human RhoA and the DH/PH domain of human ARHGEF11 Deposited 2016-04-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–181（181 aa） Fragment：UNP residues 1-181	Not recorded	GOL GLYCEROL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；293 K；2% v/v Tacsimate pH 5.0, 0.1M Sodium citrate tribasic dihydrate pH 5.6, 16% PEG 3350	Resolution 2.50 Å R-free 0.270
5JHG Crystal structure of the complex between the human RhoA and the DH/PH domain of human ARHGEF11 Deposited 2016-04-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–181（181 aa） Fragment：UNP residues 1-181	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；293 K；2% v/v Tacsimate pH 5.0, 0.1M Sodium citrate tribasic dihydrate pH 5.6, 16% PEG 3350	Resolution 2.50 Å R-free 0.270
5JHH Crystal structure of the ternary complex between the human RhoA, its inhibitor and the DH/PH domain of human ARHGEF11 Deposited 2016-04-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–181（181 aa） Fragment：UNP residues 1-181	Not recorded	GOL GLYCEROL × 2 RA0 3-{3-[ethyl(quinolin-2-yl)amino]phenyl}propanoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；293 K；2% v/v Tacsimate pH 5.0, 0.1M Sodium citrate tribasic dihydrate pH 5.6, 16% PEG 3350	Resolution 2.30 Å R-free 0.239
5JHH Crystal structure of the ternary complex between the human RhoA, its inhibitor and the DH/PH domain of human ARHGEF11 Deposited 2016-04-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–181（181 aa） Fragment：UNP residues 1-181	Not recorded	GOL GLYCEROL × 1 RA0 3-{3-[ethyl(quinolin-2-yl)amino]phenyl}propanoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.6；293 K；2% v/v Tacsimate pH 5.0, 0.1M Sodium citrate tribasic dihydrate pH 5.6, 16% PEG 3350	Resolution 2.30 Å R-free 0.239
5M6X Crystal Structure of human RhoGAP mutated in its arginine finger (R85A) in complex with RhoA.GDP.MgF3- human Deposited 2016-10-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–193（192 aa）	Not recorded	MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 MGF TRIFLUOROMAGNESATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；293 K；100 mM Bis Tris pH 5.5-6.5 20-25% (w/v) PEG3350	Resolution 2.40 Å R-free 0.272
5M6X Crystal Structure of human RhoGAP mutated in its arginine finger (R85A) in complex with RhoA.GDP.MgF3- human Deposited 2016-10-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 2–193（192 aa）	Not recorded	MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 MGF TRIFLUOROMAGNESATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；293 K；100 mM Bis Tris pH 5.5-6.5 20-25% (w/v) PEG3350	Resolution 2.40 Å R-free 0.272
5M70 Crystal Structure of human RhoGAP mutated in its arginin finger (R85A) in complex with RhoA.GDP.AlF4- human Deposited 2016-10-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 2–193（192 aa）	Not recorded	MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；293 K；100 mM Bis/Tris pH 5.8-6 PEG3350 23-26%	Resolution 2.20 Å R-free 0.277
5M70 Crystal Structure of human RhoGAP mutated in its arginin finger (R85A) in complex with RhoA.GDP.AlF4- human Deposited 2016-10-26	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 2–193（192 aa）	Not recorded	MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 ALF TETRAFLUOROALUMINATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；293 K；100 mM Bis/Tris pH 5.8-6 PEG3350 23-26%	Resolution 2.20 Å R-free 0.277
5ZHX Crystal structure of SmgGDS-558 and farnesylated RhoA complex Deposited 2018-03-13	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain e 1–193（193 aa）	Mutation：L193A	FAR FARNESYL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；283 K；0.2M Sodium malonate, 20% PEG 3350	Resolution 3.50 Å R-free 0.306
5ZHX Crystal structure of SmgGDS-558 and farnesylated RhoA complex Deposited 2018-03-13	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain f 1–193（193 aa）	Mutation：L193A	FAR FARNESYL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；283 K；0.2M Sodium malonate, 20% PEG 3350	Resolution 3.50 Å R-free 0.306
5ZHX Crystal structure of SmgGDS-558 and farnesylated RhoA complex Deposited 2018-03-13	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain g 1–193（193 aa）	Mutation：L193A	FAR FARNESYL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；283 K；0.2M Sodium malonate, 20% PEG 3350	Resolution 3.50 Å R-free 0.306
5ZHX Crystal structure of SmgGDS-558 and farnesylated RhoA complex Deposited 2018-03-13	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain h 1–193（193 aa）	Mutation：L193A	FAR FARNESYL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；283 K；0.2M Sodium malonate, 20% PEG 3350	Resolution 3.50 Å R-free 0.306
6BC0 A Complex between PH Domain of p190RhoGEF and Activated RhoA Bound to a GTP Analog Deposited 2017-10-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–181（181 aa）	Not recorded	MG MAGNESIUM ION × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；20-24% PEG 3350, 100mM TrisCl, 200mM NaCl	Resolution 2.20 Å R-free 0.281
6BCA A Complex between PH Domain of LbcRhoGEF (AKAP-Lbc) and Activated RhoA Bound to a GTP Analog Deposited 2017-10-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–181（181 aa）	Not recorded	MG MAGNESIUM ION × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；24-26% PEG 3350, 100mM Bis-Tris, 200mM ammonium sulfate	Resolution 2.00 Å R-free 0.234
6BCA A Complex between PH Domain of LbcRhoGEF (AKAP-Lbc) and Activated RhoA Bound to a GTP Analog Deposited 2017-10-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–181（181 aa）	Not recorded	MG MAGNESIUM ION × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；24-26% PEG 3350, 100mM Bis-Tris, 200mM ammonium sulfate	Resolution 2.00 Å R-free 0.234
6BCB A Complex between PH Domain of p114RhoGEF and Activated RhoA Bound to a GTP Analog Deposited 2017-10-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–181（181 aa）	Not recorded	GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；22-24% PEG 3350, 100mM Bis-Tris, 200mM NaCl	Resolution 1.40 Å R-free 0.165
6KX2 Crystal structure of GDP bound RhoA protein Deposited 2019-09-09	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa）	Mutation：C16V, C20S, C83V, C159T	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；289 K；10 mg/mL mutant, 0.2M NaCl; 0.1M acetate Na (pH 4.5) and 1.26M ammonium sulfate	Resolution 1.45 Å R-free 0.210
6KX3 Crystal structure of RhoA protein with covalent inhibitor DC-Rhoin Deposited 2019-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa）	Mutation：C16V, C20S, C83V, C159T	GDP GUANOSINE-5'-DIPHOSPHATE × 1 8ZO prop-2-enyl (3R)-1,1-bis(oxidanylidene)-2,3-dihydro-1-benzothiophene-3-carboxylate × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；289 K；10 mg/mL mutant, 0.2M NaCl, 0.1M acetate Na (pH 4.5), 1.26M ammonium sulfate	Resolution 1.98 Å R-free 0.268
6R3V Crystal Structure of RhoA-GDP-Pi in Complex with RhoGAP Deposited 2019-03-21	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–193（193 aa）	Mutation：YES [F25N]	PO4 PHOSPHATE ION × 2 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 DTT 2,3-DIHYDROXY-1,4-DITHIOBUTANE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；293 K；Equal amounts of reservoir solution containing 18% PEG2000 MME, 100 mM MES, pH 6.0, 10 mM MgCl2, 3 mM DTT, 3 mM NaN3, 120 mM ammonium sulphate and stock solution of the RhoA/RhoGAP protein complex at 800 mM in 20 mM Tris.HCl, pH 7.4, with 2 mM AlCl3, 10 mM MgCl2, and 20 mM NaF.	Resolution 1.75 Å R-free 0.207
6V6M Crystal structure of an inactive state of GMPPNP-bound RhoA Deposited 2019-12-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa）	Mutation：F25N	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1 DIO 1,4-DIETHYLENE DIOXIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.3；277 K；20-24% PEG8K, 15% Dioxane, 0.1M Tris pH8.0	Resolution 1.39 Å R-free 0.236
6V6U Crystal structure of RhoA-GDP with novel Switch I conformation Deposited 2019-12-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa） Fragment：C-terminal trancated at residue 181	Mutation：F25N	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 DIO 1,4-DIETHYLENE DIOXIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.3；277 K；20-24% PEG8K, 15% Dioxane, 0.1M Tris pH8.0	Resolution 1.16 Å R-free 0.185
6V6V Crystal structure of oncogenic RhoA mutant G14V complexed with GDP Deposited 2019-12-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa） Fragment：C-terminal trancated at residue 181	Mutation：G14V, F25N	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 DIO 1,4-DIETHYLENE DIOXIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.3；277 K；20-24% PEG8K, 15% Dioxane, 0.1M Tris pH8.0	Resolution 1.40 Å R-free 0.223
7G80 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1041785508 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	K34 5-(1,3-thiazol-2-yl)-1H-1,2,4-triazole × 1 DMS DIMETHYL SULFOXIDE × 3 FMT FORMIC ACID × 13	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.67 Å R-free 0.230
7G81 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z104474512 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	H04 1-(2-ethoxyphenyl)piperazine × 2 DMS DIMETHYL SULFOXIDE × 4 FMT FORMIC ACID × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.51 Å R-free 0.216
7G82 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1079512010 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	UWS 6-methyl-2-[(3-methyl-1,2-oxazol-5-yl)methyl]pyridazin-3(2H)-one × 3 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 15	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.41 Å R-free 0.209
7G83 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z108545814 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	YX2 3-propanamido-1-benzofuran-2-carboxamide × 2 DMS DIMETHYL SULFOXIDE × 4 FMT FORMIC ACID × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.31 Å R-free 0.205
7G84 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1102357527 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	YX6 N-[(3R)-6-oxopiperidin-3-yl]-1,3-thiazole-4-carboxamide × 1 DMS DIMETHYL SULFOXIDE × 4 FMT FORMIC ACID × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.81 Å R-free 0.232
7G85 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z111529496 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	LXA ~{N}-(1~{H}-benzimidazol-2-ylmethyl)-2-methoxy-ethanamide × 2 DMS DIMETHYL SULFOXIDE × 6 FMT FORMIC ACID × 13	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.74 Å R-free 0.223
7G86 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1137725943 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	YXB N-[(1H-indol-4-yl)methyl]ethanamine × 3 DMS DIMETHYL SULFOXIDE × 6 FMT FORMIC ACID × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.70 Å R-free 0.229
7G87 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1148165337 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	YG5 2-(1H-indazol-1-yl)-N,N-dimethylacetamide × 1 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.05 Å R-free 0.241
7G88 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1148747945 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	WKY N-(3-methylpyridin-4-yl)acetamide × 1 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.87 Å R-free 0.244
7G89 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1192341021 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	ZT7 1-(5-amino-2H-isoindol-2-yl)ethan-1-one × 2 DMS DIMETHYL SULFOXIDE × 4 FMT FORMIC ACID × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.90 Å R-free 0.244
7G8A ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z100642432 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	WJ7 2-bromo-4-fluoro-N,N-dimethylbenzamide × 1 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 15	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.50 Å R-free 0.211
7G8B ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z100643660 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	LFO N,1-dimethyl-1H-indole-3-carboxamide × 4 DMS DIMETHYL SULFOXIDE × 4 FMT FORMIC ACID × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.42 Å R-free 0.216
7G8C ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1037511924 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	YXO 1-(difluoromethyl)-1H-indol-5-amine × 1 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.18 Å R-free 0.255
7G8D ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z104474228 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 12 60P 3-methylthiophene-2-carboxylic acid × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.94 Å R-free 0.236
7G8E ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z104479710 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 12 YXH 1-(1H-benzimidazol-2-yl)methanamine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.79 Å R-free 0.223
7G8F ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1079168976 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	YXK [1-(2,2,2-trifluoroethyl)-1H-imidazol-2-yl]acetonitrile × 1 DMS DIMETHYL SULFOXIDE × 4 FMT FORMIC ACID × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.42 Å R-free 0.215
7G8G ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z111529496 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	LXA ~{N}-(1~{H}-benzimidazol-2-ylmethyl)-2-methoxy-ethanamide × 2 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.92 Å R-free 0.251
7G8H ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1198180782 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	YXU 5-methoxy-1H-pyrrolo[3,2-b]pyridine × 3 DMS DIMETHYL SULFOXIDE × 8 FMT FORMIC ACID × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.67 Å R-free 0.218
7G8I ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1198316457 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	YXY 4,4-difluorocyclohexane-1-carboxamide × 1 DMS DIMETHYL SULFOXIDE × 3 FMT FORMIC ACID × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.47 Å R-free 0.273
7G8J ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1216861874 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	YYI 5-(difluoromethoxy)pyridin-2(3H)-one × 1 DMS DIMETHYL SULFOXIDE × 4 FMT FORMIC ACID × 8	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.99 Å R-free 0.281
7G8K ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1217131798 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	YZK (3M)-3-(2-methyl-1H-imidazol-1-yl)pyridine × 3 DMS DIMETHYL SULFOXIDE × 6 FMT FORMIC ACID × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.49 Å R-free 0.216
7G8L ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1251207602 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	RWS 1-(5-methyl-1,3,4-thiadiazol-2-yl)piperidine × 4 DMS DIMETHYL SULFOXIDE × 6 FMT FORMIC ACID × 13	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.60 Å R-free 0.229
7G8M ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1255459547 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	Z0I N-(1H-indol-7-yl)acetamide × 1 DMS DIMETHYL SULFOXIDE × 3 FMT FORMIC ACID × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.03 Å R-free 0.260
7G8N ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1262549981 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	Z1L 1-anilinocyclopropane-1-carboxylic acid × 1 DMS DIMETHYL SULFOXIDE × 3 FMT FORMIC ACID × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.32 Å R-free 0.283
7G8O ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1267800292 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	O2A N-methyl-1H-indole-7-carboxamide × 3 DMS DIMETHYL SULFOXIDE × 4 FMT FORMIC ACID × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.58 Å R-free 0.230
7G8P ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1269184613 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	Z2F 1,3-benzothiazole-6-sulfonamide × 1 DMS DIMETHYL SULFOXIDE × 3 FMT FORMIC ACID × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.21 Å R-free 0.324
7G8Q ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1269220427 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	Z2Z 8-(methanesulfonyl)quinoline × 2 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 13	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.56 Å R-free 0.207
7G8R ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1270087714 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	Z5Z (2R,6S)-2,6-dimethyl-4-(3-methyl-1,2,4-thiadiazol-5-yl)morpholine × 1 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 13	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.44 Å R-free 0.207
7G8S ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1270393711 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	Z5C 5-(methoxymethyl)-1,2-oxazole-3-carboxamide × 3 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 13	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.60 Å R-free 0.222
7G8T ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1273312142 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 14 Z4X 2-ethoxy-3-fluoro-N,N-dimethylbenzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.39 Å R-free 0.198
7G8U ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z131833926 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 3 FMT FORMIC ACID × 6 Z3O (3S)-3-{[(4R)-4-methyl-3,4-dihydropyridin-1(2H)-yl]methyl}-3H-indole × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.44 Å R-free 0.294
7G8V ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z133716556 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	Z3H N-[(4R)-3,4-dihydro-2H-1-benzopyran-4-yl]methanesulfonamide × 1 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.45 Å R-free 0.219
7G8W ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1416193393 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	Z6I 4-(5-methyl-1H-pyrazol-4-yl)piperidine × 1 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 13	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.94 Å R-free 0.250
7G8X ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1416571195 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	Z7T 2-(cyclopentylamino)pyridine-4-carboxamide × 1 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 12	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.71 Å R-free 0.227
7G8Y ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1449748885 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	WZY N-(4-methoxyphenyl)glycinamide × 1 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.75 Å R-free 0.222
7G8Z ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1493056027 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 7 FMT FORMIC ACID × 14 Z9I 1-[(2R)-1-(methanesulfonyl)pyrrolidin-2-yl]methanamine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.51 Å R-free 0.221
7G90 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1509195674 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	ZA9 4-[(3S)-piperidin-3-yl]-1H-indole × 1 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.91 Å R-free 0.249
7G91 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1509257513 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	ZBH (4S)-N,2-dimethyl-4,5,6,7-tetrahydro-1,3-benzothiazole-4-carboxamide × 1 DMS DIMETHYL SULFOXIDE × 3 FMT FORMIC ACID × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.29 Å R-free 0.253
7G92 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1545313172 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	LWA (2~{S})-~{N}-(4-aminocarbonylphenyl)oxolane-2-carboxamide × 1 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.87 Å R-free 0.237
7G93 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1565771450 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	VW7 N-(8-methyl-1,2,3,4-tetrahydroquinolin-5-yl)acetamide × 2 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.69 Å R-free 0.225
7G94 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1575337975 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	ZC9 (2P)-5-fluoro-2-(1H-pyrazol-5-yl)pyridine × 3 DMS DIMETHYL SULFOXIDE × 4 FMT FORMIC ACID × 13	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.47 Å R-free 0.224
7G95 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z165170770 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	W0Y N-methyl-4-sulfamoylbenzamide × 4 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.55 Å R-free 0.218
7G96 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z1203730981 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	ZCI 2-bromo-1H-imidazole × 2 DMS DIMETHYL SULFOXIDE × 3 FMT FORMIC ACID × 9	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.30 Å R-free 0.266
7G97 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z57899718 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	APY 2-AMINOMETHYL-PYRIDINE × 1 DMS DIMETHYL SULFOXIDE × 3 FMT FORMIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.30 Å R-free 0.249
7G98 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with Z4605084898 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 2 FMT FORMIC ACID × 4 ZDL 1,3-dimethylimidazolidine × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.88 Å R-free 0.295
7G99 ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with PCM-0102102-001 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	ZE9 1-[(3R,5R)-5-(furan-2-yl)-3-(5-methylfuran-2-yl)pyrazolidin-1-yl]ethan-1-one × 2 DMS DIMETHYL SULFOXIDE × 6 FMT FORMIC ACID × 13	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.78 Å R-free 0.237
7G9A ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with PCM-0102113-001 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 2 FMT FORMIC ACID × 11 ZEK 3-acetamido-N-methylbenzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.58 Å R-free 0.295
7G9B ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with PCM-0102116-001 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 2 FMT FORMIC ACID × 7 ZG0 N-(3-methylphenyl)acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.55 Å R-free 0.298
7G9C ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with PCM-0102141-001 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 4 FMT FORMIC ACID × 8 ZFI N-[2-(methanesulfonyl)phenyl]acetamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.69 Å R-free 0.274
7G9D ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with PCM-0102179-001 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 2 FMT FORMIC ACID × 9 T7Y N-[3-(2-oxopyrrolidin-1-yl)phenyl]acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.66 Å R-free 0.286
7G9E ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with PCM-0102197-001 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 10 ZG6 N-(3-methyl-1,2-oxazol-5-yl)acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.15 Å R-free 0.292
7G9F ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with PCM-0102209-001 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 4 FMT FORMIC ACID × 10 ZGF N-(6-chloro-2H-1,3-benzodioxol-5-yl)acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.94 Å R-free 0.260
7G9G ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with PCM-0102236-001 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 3 FMT FORMIC ACID × 11 ZGK N-(2-methoxyphenyl)acetamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.08 Å R-free 0.286
7G9H ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with PCM-0102245-001 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 2 FMT FORMIC ACID × 7 KLU (2S)-4-(chloroacetyl)-3,4-dihydro-2H-1,4-benzoxazine-2-carboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.75 Å R-free 0.274
7G9I ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with PCM-0102253-001 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	ZGQ N-[(2-methylphenyl)methyl]acetamide × 1 DMS DIMETHYL SULFOXIDE × 4 FMT FORMIC ACID × 10	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 2.20 Å R-free 0.274
7G9J ARHGEF2 PanDDA analysis group deposition -- ARHGEF2 and RhoA in complex with PCM-0102281-001 Deposited 2023-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	ZGX 1-(3,4-dihydropyrazin-1(2H)-yl)ethan-1-one × 1 DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 11	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；100 mM Tris, 2.6M sodium formate	Resolution 1.97 Å R-free 0.245
7QSC GTPase IN COMPLEX WITH GDP.MGF3- Deposited 2022-01-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 2–193（192 aa） Chain D 2–193（192 aa）	Mutation：Y34(F3Y) Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：Y34(F3Y) Non-standard monomer：Yes (specific site not provided by mmCIF)	GDP GUANOSINE-5'-DIPHOSPHATE × 2 MGF TRIFLUOROMAGNESATE × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；Protein stock of RhoA-Y34F3Y 0.7 mM, RhoGAP-R85A 0.7 mM in a buffer of BisTris-HCl, pH 6.0, NaCl 150 mM, MgCl2 5 mM, NaF 10 mM, DTT 1 mM mixed 1:1.2 ratio with the precipitant solution of 0.1 M BisTris-HCl, pH 5.8, PEG3350 26% (w/v).	Resolution 1.91 Å R-free 0.294
7QTM Transition state analogue of small G protein in complex with relevant GAP Deposited 2022-01-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 2–193（192 aa） Chain I 2–193（192 aa）	Mutation：Y34(F2Y) Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：Y34(F2Y) Non-standard monomer：Yes (specific site not provided by mmCIF)	GDP GUANOSINE-5'-DIPHOSPHATE × 2 MGF TRIFLUOROMAGNESATE × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；A 1:1 ratio of protein buffer (RhoA 0.7 mM, RhoGAP-R85A 0.7 M, BisTris-HCl pH = 6.0, NaCl 150 mM, MgCl2 5 mM, NaF 10 mM, DTT 1 mM) to precipitant (0.1 M BisTris-HCl pH = 5.8, PEG3350 25% (w/v)) was used	Resolution 2.25 Å R-free 0.304
7WZA An open conformation Form 1 of switch II for RhoA Deposited 2022-02-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa）	Mutation：C16V,C20S,C83V,C159T	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；20% PEG 3350, 0.2M potassium formate	Resolution 1.50 Å R-free 0.220
7WZC An open conformation Form2 of switch II for RhoA GDP-bound state Deposited 2022-02-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa） Fragment：C16V,C20S,C83V,C159T	Not recorded	GOL GLYCEROL × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289 K；0.1M MES, pH6.0, 30% PEG 600, 5% PEG 1000, 10% glycerol	Resolution 1.80 Å R-free 0.264
8BNT The DH domain of ARHGEF2 bound to RhoA Deposited 2022-11-25	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–184（184 aa）	Not recorded	DMS DIMETHYL SULFOXIDE × 5 FMT FORMIC ACID × 15	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；293 K；2.6 M sodium formate, 100 mM Tris	Resolution 1.40 Å R-free 0.175
8FC7 Cryo-EM structure of the human TRPV4 - RhoA in complex with GSK2798745 Deposited 2022-12-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–193（193 aa） Chain F 1–193（193 aa） Chain G 1–193（193 aa） Chain H 1–193（193 aa）	Not recorded	XPW 1-({(5S,7S)-3-[5-(2-hydroxypropan-2-yl)pyrazin-2-yl]-7-methyl-2-oxo-1-oxa-3-azaspiro[4.5]decan-7-yl}methyl)-1H-benzimidazole-6-carbonitrile × 4 MG MAGNESIUM ION × 4 GDP GUANOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8FC9 Cryo-EM structure of the human TRPV4 - RhoA, apo condition Deposited 2022-12-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–193（193 aa） Chain F 1–193（193 aa） Chain G 1–193（193 aa） Chain H 1–193（193 aa）	Not recorded	MG MAGNESIUM ION × 4 GDP GUANOSINE-5'-DIPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.75 Å
8FCB Cryo-EM structure of the human TRPV4 - RhoA in complex with GSK1016790A Deposited 2022-12-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–193（193 aa） Chain F 1–193（193 aa） Chain G 1–193（193 aa） Chain H 1–193（193 aa）	Not recorded	XQ3 N-[(2S)-1-{4-[N-(2,4-dichlorobenzene-1-sulfonyl)-L-seryl]piperazin-1-yl}-4-methyl-1-oxopentan-2-yl]-1-benzothiophene-2-carboxamide × 4 Y01 CHOLESTEROL HEMISUCCINATE × 4 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.52 Å
8FPW Crystal structure of tumor related RhoA mutant A161V in complex with GDP Deposited 2023-01-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa）	Mutation：F25N, A161V	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 DIO 1,4-DIETHYLENE DIOXIDE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；277 K；20-24% PEG8K, 15% Dioxane, 0.1M Tris pH8.0	Resolution 1.40 Å R-free 0.208
8FPX Crystal structure of tumor related RhoA mutant A161P in complex with GDP Deposited 2023-01-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa）	Mutation：F25N, A161P	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1 DIO 1,4-DIETHYLENE DIOXIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；277 K；20-24% PEG8K, 15% Dioxane, 0.1M Tris pH8.0	Resolution 1.47 Å R-free 0.225
8GI3 Crystal structure of RhoA mutant L69P complexed with GDP Deposited 2023-03-13	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–193（193 aa）	Mutation：L69P	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 5.1；293.2 K；0.2 M Ammonium citrate dibasic (pH 5.1), 20% PEG3350	Resolution 1.52 Å R-free 0.209
8GI6 Crystal structure of RhoA mutant L69R complexed with GDP Deposited 2023-03-13	Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–193（193 aa）	Mutation：L69R	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 5.7；293.15 K；0.1 M Na acetate (pH 5.7), 0.5 mM Na citrate, 26% PEG4000, 5% glycerol	Resolution 1.40 Å R-free 0.182
8JVJ Structure of human TRPV4 with antagonist A2 and RhoA Deposited 2023-06-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain E 1–193（193 aa） Chain F 1–193（193 aa） Chain G 1–193（193 aa） Chain H 1–193（193 aa）	Not recorded	F9M [6-[[4-(2,4-dimethyl-1,3-thiazol-5-yl)-1,3-thiazol-2-yl]amino]pyridin-3-yl]-[(1~{S},5~{R})-3-[5-(trifluoromethyl)pyrimidin-2-yl]-3,8-diazabicyclo[3.2.1]octan-8-yl]methanone × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.44 Å
8ZNY Small GTPase RhoA Y42C mutant in complex with GDP Deposited 2024-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa）	Mutation：Y42C	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289.15 K；0.2 M Ammonium acetate, o.1 M Sodium acetate trihydrate (pH 4.6), 30% PEG4000	Resolution 1.65 Å R-free 0.217
8ZO0 Samll GTPase RhoA Y42C mutant in complex with GTP analogue Deposited 2024-05-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa）	Mutation：Y42C	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289.15 K；0.1 M Bis-Tris (pH 5.5), 25% PEG3350	Resolution 2.21 Å R-free 0.240
9AX5 Cryo-EM structure of Phospholipase C epsilon PH-C terminus in complex with RhoA-GTP Deposited 2024-03-05	Different construct Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 2–193（192 aa）	Not recorded	CA CALCIUM ION × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9IQX Cryo-EM structure of the human TRPV4-RhoA in complex with AH001 Deposited 2024-07-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1–193（193 aa） Chain F 1–193（193 aa）	Not recorded	P5S O-[(R)-{[(2R)-2,3-bis(octadecanoyloxy)propyl]oxy}(hydroxy)phosphoryl]-L-serine × 2 U6L (1~{R})-1-(3-ethylphenyl)ethane-1,2-diol × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.37 Å
9IQY Cryo-EM structure of human TRPV4 intracellular domain in complex with GTPase RhoA Deposited 2024-07-13	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain J 1–193（193 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.16 Å
9J0G Crystal structure of RhoA-TP1001 complex Deposited 2024-08-02	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–193（193 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；289 K；0.5 M Lithium sulfate monohydrate,0.1 M HEPES pH 7.5,30% w/v Polyethylene glycol 3,350	Resolution 3.10 Å R-free 0.354
9J0G Crystal structure of RhoA-TP1001 complex Deposited 2024-08-02	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–193（193 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；289 K；0.5 M Lithium sulfate monohydrate,0.1 M HEPES pH 7.5,30% w/v Polyethylene glycol 3,350	Resolution 3.10 Å R-free 0.354
9J0G Crystal structure of RhoA-TP1001 complex Deposited 2024-08-02	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–193（193 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；289 K；0.5 M Lithium sulfate monohydrate,0.1 M HEPES pH 7.5,30% w/v Polyethylene glycol 3,350	Resolution 3.10 Å R-free 0.354
9J0G Crystal structure of RhoA-TP1001 complex Deposited 2024-08-02	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–193（193 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 2 U6L (1~{R})-1-(3-ethylphenyl)ethane-1,2-diol × 1 EPE 4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions EVAPORATION；289 K；0.5 M Lithium sulfate monohydrate,0.1 M HEPES pH 7.5,30% w/v Polyethylene glycol 3,350	Resolution 3.10 Å R-free 0.354
9N4A Wild-type RhoA GTPase bound to GppNHp Deposited 2025-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa）	Not recorded	DIO 1,4-DIETHYLENE DIOXIDE × 1 MG MAGNESIUM ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.18 K；2 uL protein (10 mg/mL RhoA-GppNHp, 25 mM Tris-HCl pH 8.0, 2 mM MgCl2, 10 mM BME) + 2 uL of crystallization solution over 500 uL reservoir of crystallization solution. Crystallization solution: 25% dioxane, 17% PEG 8000, and 100 mM HEPES pH 6.9	Resolution 1.95 Å R-free 0.221
9N4A Wild-type RhoA GTPase bound to GppNHp Deposited 2025-02-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–181（181 aa）	Not recorded	DIO 1,4-DIETHYLENE DIOXIDE × 1 MG MAGNESIUM ION × 2 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；291.18 K；2 uL protein (10 mg/mL RhoA-GppNHp, 25 mM Tris-HCl pH 8.0, 2 mM MgCl2, 10 mM BME) + 2 uL of crystallization solution over 500 uL reservoir of crystallization solution. Crystallization solution: 25% dioxane, 17% PEG 8000, and 100 mM HEPES pH 6.9	Resolution 1.95 Å R-free 0.221
9N4B RhoA GTPase R70A bound to GTPgammaS Deposited 2025-02-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 3–181（179 aa）	Mutation：R70A	MG MAGNESIUM ION × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 SO4 SULFATE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；277.15 K；2 uL protein (8 mg/mL RhoA R70A bound to GTPgammaS in 25 mM Tris-HCl pH8.0, 2 mM MgCl2, and 10 mM BME) + 2 uL crystallization reagent sitting above 500 uL crystallization reagent. Crystallization reagent: 250 mM ammonium sulfate, 1.50 M lithium sulfate, and 100 mM sodium citrate pH 5.6	Resolution 3.00 Å R-free 0.247
9N4C RhoA GTPase E102A bound to GTPgammaS Deposited 2025-02-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa）	Mutation：E102A	GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 1 IOD IODIDE ION × 5 CL CHLORIDE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；2 uL protein (8 mg/mL RhoA E102A bound to GTPgammaS, 25 mM Tris-HCl pH 8.0, 2 mM MgCl2, 10 mM BME) + 2 uL of crystallization solution over 500 uL reservoir of crystallization solution. Crystallization solution: 0.2 M Ammonium iodide, 20% PEG 3,350	Resolution 2.30 Å R-free 0.220
9N4C RhoA GTPase E102A bound to GTPgammaS Deposited 2025-02-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–181（181 aa）	Mutation：E102A	GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 1 IOD IODIDE ION × 8 CL CHLORIDE ION × 9 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；2 uL protein (8 mg/mL RhoA E102A bound to GTPgammaS, 25 mM Tris-HCl pH 8.0, 2 mM MgCl2, 10 mM BME) + 2 uL of crystallization solution over 500 uL reservoir of crystallization solution. Crystallization solution: 0.2 M Ammonium iodide, 20% PEG 3,350	Resolution 2.30 Å R-free 0.220
9N4C RhoA GTPase E102A bound to GTPgammaS Deposited 2025-02-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–181（181 aa）	Mutation：E102A	GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 2 IOD IODIDE ION × 5 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；2 uL protein (8 mg/mL RhoA E102A bound to GTPgammaS, 25 mM Tris-HCl pH 8.0, 2 mM MgCl2, 10 mM BME) + 2 uL of crystallization solution over 500 uL reservoir of crystallization solution. Crystallization solution: 0.2 M Ammonium iodide, 20% PEG 3,350	Resolution 2.30 Å R-free 0.220
9N4C RhoA GTPase E102A bound to GTPgammaS Deposited 2025-02-02	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–181（181 aa）	Mutation：E102A	GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 1 IOD IODIDE ION × 12 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277.15 K；2 uL protein (8 mg/mL RhoA E102A bound to GTPgammaS, 25 mM Tris-HCl pH 8.0, 2 mM MgCl2, 10 mM BME) + 2 uL of crystallization solution over 500 uL reservoir of crystallization solution. Crystallization solution: 0.2 M Ammonium iodide, 20% PEG 3,350	Resolution 2.30 Å R-free 0.220
9VNG Small GTPase RhoA Y42C mutant in complex with covalent inhibitor Deposited 2025-06-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa）	Mutation：Y42C	GDP GUANOSINE-5'-DIPHOSPHATE × 1 A1D9L 4-(2-nitroethyl)-1~{H}-indole × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.6；289.15 K；0.2 M Ammonium acetate, 0.1 M Sodium acetate trihydrate pH 4.6, 30% w/v Polyethylene glycol 4000	Resolution 1.43 Å R-free 0.221
9VNH Structure of wild-type RhoA in complex with GDP and magnesium ion Deposited 2025-06-30	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 8.5；289.15 K；0.2 M Ammonium chloride, 0.01 M Calcium chloride dihydrate, 0.05 M TRIS hydrochloride pH 8.5, 30% w/v Polyethylene glycol 4000	Resolution 1.79 Å R-free 0.231
9VNI Structure of the RhoA Y42C mutant featuring Thr37 coordination of magnesium ion Deposited 2025-06-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–181（181 aa）	Mutation：Y42C	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；289.15 K；10% v/v 2-Propanol, 0.1 M Sodium acetate trihydrate pH 4.0, 22% w/v Polyethylene glycol 6000	Resolution 1.83 Å R-free 0.247

129 other PDB entries and 165 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RHOA_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–193； UniProt 1–193

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8t1c
Deposition date deposition_date	2023-06-02
Structure title title	Cryo-EM structure of human TRPV4 ankyrin repeat domain in complex with GTPase RhoA
Keywords keywords	;transient receptor potential V family member 4, TRP, channel, TRPV4, TRP channels, membrane protein, GTPase, transforming protein RhoA, RhoA, ankyrin repeat domain, GDP, guanosine diphosphate ;; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	23.93 Å
Radius of gyration Rg (electron density) rg_electron	22.98 Å
Forward intensity I(0) i0	32809400.00
Molecular weight molecular_weight	43143.0 kDa
Excluded volume excluded_volume	53762 Å³
Envelope volume envelope_volume	66808 Å³
Hydration-shell volume shell_volume	24726 Å³
Envelope diameter envelope_diameter	89.6 Å
Shell Rg shell_rg	29.50 Å
Envelope Rg envelope_rg	23.29 Å
Shape Rg shape_rg	22.96 Å
Total Rg total_rg	23.85 Å
Total atoms total_atoms	6043
Residues n_residues	377
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	87.6 Å
Rg (real space) rg_real	23.95 Å
Rg uncertainty (real space) rg_real_error	0.72 Å
I(0) (real space) i0_real	3.2810e+07
I(0) uncertainty (real space) i0_real_error	4.6530e+05
Rg (reciprocal space) rg_reciprocal	23.95 Å
I(0) (reciprocal space) i0_reciprocal	32810000.0000
Solution quality estimate total_estimate	0.8346
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	26.0 Å
Skewness Skewness skewness	0.416
Kurtosis Kurtosis kurtosis	-0.153
Angular range angular_range	— – 0.3300 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	9701000.0000
Real-space data points n_real_points	65
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.663; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.870; Smooth: 0.985

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Transient receptor potential cation channel subfamily V member 4-Enhanced green fluorescent protein chimera
Molecular weight formula_weight	127717.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	6043

MADSSEGPRAGPGEVAELPGDESGTPGGEAFPLSSLANLFEGEDGSLSPSPADASRPAGPGDGRPNLRMKFQGAFRKGVPNPIDLLESTLYESSVVPGPKKAPMDSLFDYGTYRHHSSDNKRWRKKIIEKQPQSPKAPAPQPPPILKVFNRPILFDIVSRGSTADLDGLLPFLLTHKKRLTDEEFREPSTGKTCLPKALLNLSNGRNDTIPVLLDIAERTGNMREFINSPFRDIYYRGQTALHIAIERRCKHYVELLVAQGADVHAQARGRFFQPKDEGGYFYFGELPLSLAACTNQPHIVNYLTENPHKKADMRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLLKCARLFPDSNLEAVLNNDGLSPLMMAAKTGKIGIFQHIIRREVTDEDTRHLSRKFKDWAYGPVYSSLYDLSSLDTCGEEASVLEILVYNSKIENRHEMLAVEPINELLRDKWRKFGAVSFYINVVSYLCAMVIFTLTAYYQPLEGTPPYPYRTTVDYLRLAGEVITLFTGVLFFFTNIKDLFMKKCPGVNSLFIDGSFQLLYFIYSVLVIVSAALYLAGIEAYLAVMVFALVLGWMNALYFTRGLKLTGTYSIMIQKILFKDLFRFLLVYLLFMIGYASALVSLLNPCANMKVCNEDQTNCTVPTYPSCRDSETFSTFLLDLFKLTIGMGDLEMLSSTKYPVVFIILLVTYIILTFVLLLNMLIALMGETVGQVSKESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKSSDGTPDRRWCFRVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPRVVELNKNSNPDEVVVPLDSMGNPRCDGHQQGYPRKWRTDDAPLLVPRGSAAAAVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSGLRSWSHPQFEK

来源 Source

来源生物 organism	Human cytomegalovirus
通用名 common_name	HHV-5, Human herpesvirus 5
NCBI Class编号 ncbi_taxonomy_id	10359
宿主生物 host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Transforming protein RhoA
Molecular weight formula_weight	21799.2 kDa
EC 编号 ec_number	3.6.5.2
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Homo sapiens

Entity 3 Entity 3 non-polymer

Description description	GUANOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	443.2 kDa
Source method src_method	syn
Copy count entity_count	1

▼

7. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

Domain ID domain_id	8t1cE01
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.49 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	86562

fit	/app/data/saxs_computation/t1/8t1c/8t1c.fit
pddf	/app/data/pr_computation/t1/8t1c/8t1c.pr.out
profile	/app/data/saxs_computation/t1/8t1c/8t1c.dat

Cryo-EM structure of human TRPV4 ankyrin repeat domain in complex with GTPase RhoA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Transient receptor potential cation channel subfamily V member 4-Enhanced green fluorescent protein chimera

State in the Current Structure

Other States of the Same Protein in the Database

Transient receptor potential cation channel subfamily V member 4-Enhanced green fluorescent protein chimera

State in the Current Structure

Other States of the Same Protein in the Database

Transforming protein RhoA

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

7. Fold Classification (SCOP + CATH) 1 domains

CATH v4.4 (1 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)