8t7h

Quis-bound intermediate mGlu5

Method: ELECTRON MICROSCOPY D_max: 196.9 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Metabotropic glutamate receptor 5

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 20–876 Chain B； UniProt 20–876	Not recorded	Nanobody 43 × 2 QUS (S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.30 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8T7H	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3LMK Ligand Binding Domain of Metabotropoc glutamate receptor mGluR5 complexed with glutamate Deposited 2010-01-30	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 18–505（488 aa） Fragment：Ligand binding domain Chain B 18–505（488 aa） Fragment：Ligand binding domain	Mutation：C241S Mutation：C241S	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 GLU GLUTAMIC ACID × 2 MG MAGNESIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；298 K；25% PEG 8000, 0.2M NaCl, 0.1M Hepes. protein concentration 5mg/mL plus 5mM L-Glu. Cryoprotectant used: 33% PEG 8000, 0.2M NaCl and 0.1M Hepes plus 20% Glycerol, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.44 Å R-free 0.281
4OO9 Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane domain in complex with the negative allosteric modulator mavoglurant Deposited 2014-01-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 569–678（110 aa） Fragment：SEE REMARK 999 Chain A 680–836（157 aa） Fragment：SEE REMARK 999	Mutation：yes Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：yes Non-standard monomer：Yes (specific site not provided by mmCIF)	OLA OLEIC ACID × 4 2U8 Mavoglurant × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 6.8；293.1 K；24-34% v/v PEG400, 0.2 M ammonium phosphate dibasic, 0.1 M MES, pH 6.8, LIPIDIC CUBIC PHASE, temperature 293.1K	Resolution 2.60 Å R-free 0.275
5CGC Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane domain in complex with the negative allosteric modulator 3-chloro-4-fluoro-5-[6-(1H-pyrazol-1-yl)pyrimidin-4-yl]benzonitrile Deposited 2015-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 569–678（110 aa） Chain A 679–836（158 aa）	Mutation：;E579A N667Y I669A G675M C1054T C1097A T742A S753A,E579A N667Y I669A G675M C1054T C1097A T742A S753A,E579A N667Y I669A G675M C1054T C1097A T742A S753A ; Mutation：;E579A N667Y I669A G675M C1054T C1097A T742A S753A,E579A N667Y I669A G675M C1054T C1097A T742A S753A,E579A N667Y I669A G675M C1054T C1097A T742A S753A ;	OLA OLEIC ACID × 4 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 51D 3-chloro-4-fluoro-5-[6-(1H-pyrazol-1-yl)pyrimidin-4-yl]benzonitrile × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 6.8；293.1 K；24-34% V/V PEG400, 0.2 M AMMONIUM PHOSPHATE DIBASIC, 0.1 M MES, PH 6.8,	Resolution 3.10 Å R-free 0.287
5CGD Structure of the human class C GPCR metabotropic glutamate receptor 5 transmembrane domain in complex with the negative allosteric modulator 3-chloro-5-[6-(5-fluoropyridin-2-yl)pyrimidin-4-yl]benzonitrile - (HTL14242) Deposited 2015-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 569–678（110 aa） Chain A 679–836（158 aa）	Mutation：;E579A N667Y I669A G675M C1054T C1097A T742A S753A,E579A N667Y I669A G675M C1054T C1097A T742A S753A,E579A N667Y I669A G675M C1054T C1097A T742A S753A ; Mutation：;E579A N667Y I669A G675M C1054T C1097A T742A S753A,E579A N667Y I669A G675M C1054T C1097A T742A S753A,E579A N667Y I669A G675M C1054T C1097A T742A S753A ;	OLA OLEIC ACID × 4 51E 3-chloro-5-[6-(5-fluoropyridin-2-yl)pyrimidin-4-yl]benzonitrile × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 6.8；293.1 K；24-34% V/V PEG400, 0.2 M AMMONIUM PHOSPHATE DIBASIC, 0.1 M MES, PH 6.8,	Resolution 2.60 Å R-free 0.285
6FFH Crystal Structure of mGluR5 in complex with Fenobam at 2.65 A Deposited 2018-01-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 569–678（110 aa） Fragment：MGLUR5 Chain A 679–836（158 aa） Fragment：MGLUR5	Mutation：C54T C97A E579A N667Y I669A G675M T742A S753A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：C54T C97A E579A N667Y I669A G675M T742A S753A Non-standard monomer：Yes (specific site not provided by mmCIF)	OLA OLEIC ACID × 5 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 D7W 1-(3-chlorophenyl)-3-(3-methyl-5-oxidanylidene-4~{H}-imidazol-2-yl)urea × 1 OLC (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 6.8；293.1 K；24-34% V/V PEG400, 0.2 M AMMONIUM PHOSPHATE DIBASIC, 0.1 M MES, PH 6.8	Resolution 2.65 Å R-free 0.267
6FFI Crystal Structure of mGluR5 in complex with MMPEP at 2.2 A Deposited 2018-01-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 569–678（110 aa） Fragment：MGLUR5,MGLUR5,MGLUR5,MGLUR5,MGLUR5,MGLUR5,MGLUR5,MGLUR5,MGLUR5 Chain A 680–836（157 aa） Fragment：MGLUR5,MGLUR5,MGLUR5,MGLUR5,MGLUR5,MGLUR5,MGLUR5,MGLUR5,MGLUR5	Mutation：;E579A N667Y I669A G675M T742A S753A,E579A N667Y I669A G675M T742A S753A,E579A N667Y I669A G675M T742A S753A,E579A N667Y I669A G675M T742A S753A,E579A N667Y I669A G675M T742A S753A,E579A N667Y I669A G675M T742A S753A,E579A N667Y I669A G675M T742A S753A,E579A N667Y I669A G675M T742A S753A,E579A N667Y I669A G675M T742A S753A ; Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：;E579A N667Y I669A G675M T742A S753A,E579A N667Y I669A G675M T742A S753A,E579A N667Y I669A G675M T742A S753A,E579A N667Y I669A G675M T742A S753A,E579A N667Y I669A G675M T742A S753A,E579A N667Y I669A G675M T742A S753A,E579A N667Y I669A G675M T742A S753A,E579A N667Y I669A G675M T742A S753A,E579A N667Y I669A G675M T742A S753A ; Non-standard monomer：Yes (specific site not provided by mmCIF)	OLA OLEIC ACID × 7 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1 D8B 2-[2-(3-methoxyphenyl)ethynyl]-6-methyl-pyridine × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 6.8；293.1 K；24-34% V/V PEG400, 0.2 M AMMONIUM PHOSPHATE DIBASIC, 0.1 M MES, PH 6.8	Resolution 2.20 Å R-free 0.269
6N4X Metabotropic Glutamate Receptor 5 Apo Form Ligand Binding Domain Deposited 2018-11-20	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–865（846 aa） Chain B 20–865（846 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；15% PEG 3350, 0.2M Na Cacodylate pH 6.5	Resolution 4.00 Å R-free 0.282
6N4Y Metabotropic Glutamate Receptor 5 Extracellular Domain with Nb43 Deposited 2018-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 21–571（551 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；18-20% PEG 3350 0.15M Potassium Nitrate 1% Benzamidine	Resolution 3.26 Å R-free 0.251
6N4Y Metabotropic Glutamate Receptor 5 Extracellular Domain with Nb43 Deposited 2018-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 21–571（551 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；18-20% PEG 3350 0.15M Potassium Nitrate 1% Benzamidine	Resolution 3.26 Å R-free 0.251
6N4Y Metabotropic Glutamate Receptor 5 Extracellular Domain with Nb43 Deposited 2018-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 21–571（551 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；18-20% PEG 3350 0.15M Potassium Nitrate 1% Benzamidine	Resolution 3.26 Å R-free 0.251
6N4Y Metabotropic Glutamate Receptor 5 Extracellular Domain with Nb43 Deposited 2018-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 21–571（551 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；293 K；18-20% PEG 3350 0.15M Potassium Nitrate 1% Benzamidine	Resolution 3.26 Å R-free 0.251
6N50 Metabotropic Glutamate Receptor 5 Extracellular Domain in Complex with Nb43 and L-quisqualic acid Deposited 2018-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 21–571（551 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 QUS (S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；100 mM NaCl 50 mM ADA pH 7.0 20% PEG 4000	Resolution 3.75 Å R-free 0.300
6N50 Metabotropic Glutamate Receptor 5 Extracellular Domain in Complex with Nb43 and L-quisqualic acid Deposited 2018-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 21–571（551 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 QUS (S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；100 mM NaCl 50 mM ADA pH 7.0 20% PEG 4000	Resolution 3.75 Å R-free 0.300
6N50 Metabotropic Glutamate Receptor 5 Extracellular Domain in Complex with Nb43 and L-quisqualic acid Deposited 2018-11-20	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 21–571（551 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 QUS (S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；293 K；100 mM NaCl 50 mM ADA pH 7.0 20% PEG 4000	Resolution 3.75 Å R-free 0.300
6N51 Metabotropic Glutamate Receptor 5 bound to L-quisqualate and Nb43 Deposited 2018-11-20	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 23–826（804 aa） Chain B 23–826（804 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4 QUS (S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；additional 0.1%OG was added to the sample right before applying sample to grid; 3.5ul sample was applied; blot for 1 second before plunging;	Resolution 4.00 Å
6N52 Metabotropic Glutamate Receptor 5 Apo Form Deposited 2018-11-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–839（820 aa） Chain B 20–839（820 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 4	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；100mM NaCl, 20 mM HEPES pH 7.5, 5uM FFMTEB added as a negative allosteric modulator. cryo-EM vitrification conditions Cryogen ETHANE；Addition 0.0005% Amphipol A8-35was added to sample prior to apply to grid; 3.5ul sample was applied; blot for 1s before plunging	Resolution 4.00 Å
7FD8 Thermostabilised full length human mGluR5-5M bound with L-quisqualic acid Deposited 2021-07-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 21–856（836 aa） Chain B 21–856（836 aa）	Mutation：H350L, N445A, T742A, S753A, T777A, I799A, A813L Mutation：H350L, N445A, T742A, S753A, T777A, I799A, A813L	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 QUS (S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID × 2 Y01 CHOLESTEROL HEMISUCCINATE × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force was 10, 3.5 seconds blotting time	Resolution 3.80 Å
7FD9 Thermostabilised full length human mGluR5-5M with orthosteric antagonist, LY341495 Deposited 2021-07-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 21–856（836 aa） Chain B 21–856（836 aa）	Mutation：H350L, N445A, T742A, S753A, T777A, I799A, A813L Mutation：H350L, N445A, T742A, S753A, T777A, I799A, A813L	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 Z99 2-[(1S,2S)-2-carboxycyclopropyl]-3-(9H-xanthen-9-yl)-D-alanine × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force was 10, 3.5 seconds blotting time	Resolution 4.00 Å
7P2L thermostabilised 7TM domain of human mGlu5 receptor bound to photoswitchable ligand alloswitch-1 Deposited 2021-07-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 569–678（110 aa） Chain A 679–836（158 aa）	Mutation：E579A,N667Y,I669A,G675M,T742A,S753A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：E579A,N667Y,I669A,G675M,T742A,S753A Non-standard monomer：Yes (specific site not provided by mmCIF)	4YI 2-chloranyl-~{N}-[2-methoxy-4-[(~{E})-pyridin-2-yldiazenyl]phenyl]benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；295 K；0.15-0.25 M ammonium phosphate dibasic, 22-24 % polyethylene glycol 400, either with 0.10 M 2-(N-morpholino)ethanesulfonic acid (MES) pH 6.7-6.8 or 0.1 M HEPES pH 6.8	Resolution 2.54 Å R-free 0.285
8T6J CDPPB-bound inactive mGlu5 Deposited 2023-06-16	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 20–876（857 aa） Chain B 20–876（857 aa）	Not recorded	YKU 3-cyano-N-(1,3-diphenyl-1H-pyrazol-5-yl)benzamide × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.50 Å
8T8M Quis-bound intermediate mGlu5 Deposited 2023-06-22	Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 20–876（857 aa） Chain B 20–876（857 aa）	Not recorded	QUS (S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8TAO Quis and CDPPB bound active mGlu5 Deposited 2023-06-27	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 20–876（857 aa） Chain B 20–876（857 aa）	Not recorded	QUS (S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID × 2 YKU 3-cyano-N-(1,3-diphenyl-1H-pyrazol-5-yl)benzamide × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
8X0B Human FL Metabotropic glutamate receptor 5, mGlu5-5M with Quisqualate and VU0424465 Deposited 2023-11-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 21–856（836 aa） Chain B 21–856（836 aa）	Mutation：T742A, S753A, T777A, I799A, A813L,N445,H350L Mutation：T742A, S753A, T777A, I799A, A813L,N445,H350L	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 QUS (S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID × 2 XQT VU0424465 × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8X0C Human FL Metabotropic glutamate receptor 5, mGlu5-5M with quisqualate and VU0424465, conformer 1 Deposited 2023-11-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 21–856（836 aa） Chain B 21–856（836 aa）	Mutation：T742A,S753A,T777A,I799A,A813L,N455A,H350L Mutation：T742A,S753A,T777A,I799A,A813L,N455A,H350L	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 QUS (S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID × 2 XQT VU0424465 × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blotting time was 5 seconds, blot force of 10	Resolution 3.20 Å
8X0D Human FL Metabotropic glutamate receptor 5, mGlu5-5M with quisqualate and VU0424465, conformer 2 Deposited 2023-11-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 21–856（836 aa） Chain B 21–856（836 aa）	Mutation：T742A,S753A,T777A,I799A,A813L,N445A,H350L Mutation：T742A,S753A,T777A,I799A,A813L,N445A,H350L	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 QUS (S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID × 2 XQT VU0424465 × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blotting time of 5 seconds and blot force of 10	Resolution 3.50 Å
8X0E Human FL Metabotropic glutamate receptor 5, mGlu5-5M with agonist and PAM, W785A mutant Deposited 2023-11-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 21–856（836 aa） Chain B 21–856（836 aa）	Mutation：T742A,S753A,T777A,I799A,A813L,W785A,H350L Mutation：T742A,S753A,T777A,I799A,A813L,W785A,H350L	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 QUS (S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE；Blot force was set to 0	Resolution 3.40 Å
8X0F Human FL Metabotropic glutamate receptor 5, mGlu5-5M with quisqualate and PAM VU29 Deposited 2023-11-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 21–856（836 aa） Chain B 21–856（836 aa）	Mutation：T742A, S753A, T777A, I799A, A813L,N445A,H350L Mutation：T742A, S753A, T777A, I799A, A813L,N445A,H350L	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 QUS (S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID × 2 XRQ N-(1,3-diphenyl-1H-pyrazol-5-yl)-4-nitrobenzamide × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8X0G Human FL Metabotropic glutamate receptor 5, mGlu5-5M with quisqualate, Acc conformation (purified with PAM VU0409551 but not modelled) Deposited 2023-11-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 21–856（836 aa） Chain B 21–856（836 aa）	Mutation：T742A, S753A, T777A, I799A, A813L,N445A,H350L Mutation：T742A, S753A, T777A, I799A, A813L,N445A,H350L	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 QUS (S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8X0H Human FL Metabotropic glutamate receptor 5, mGlu5-5M with quisqualate, Rcc conformation Deposited 2023-11-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 21–856（836 aa） Chain B 21–856（836 aa）	Mutation：T742A, S753A, T777A, I799A, A813L,N445A,H350L Mutation：T742A, S753A, T777A, I799A, A813L,N445A,H350L	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2 QUS (S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.10 Å
9HC0 Dark structure of the human metabotropic glutamate receptor 5 transmembrane domain bound to photoswitchable ligand alloswitch-1 Deposited 2024-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 569–678（110 aa） Chain A 680–836（157 aa）	Mutation：E579A,N667Y,I669A,G675M,T742A,S753A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：E579A,N667Y,I669A,G675M,T742A,S753A Non-standard monomer：Yes (specific site not provided by mmCIF)	OLA OLEIC ACID × 5 4YI 2-chloranyl-~{N}-[2-methoxy-4-[(~{E})-pyridin-2-yldiazenyl]phenyl]benzamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 7.2；293 K；PEG300, di-ammonium hydrogen phosphate, 1,6-hexanediol, BIS-TRIS	Resolution 2.33 Å R-free 0.271
9HC3 Apo-state structure of the human metabotropic glutamate receptor 5 transmembrane domain freeze-trapped after light activation of photoswitchable ligand alloswitch-1 Deposited 2024-11-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 569–678（110 aa） Chain A 680–836（157 aa）	Mutation：E579A,N667Y,I669A,G675M,T742A,S753A Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：E579A,N667Y,I669A,G675M,T742A,S753A Non-standard monomer：Yes (specific site not provided by mmCIF)	OLA OLEIC ACID × 4	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；pH 7.2；293 K；PEG300, di-ammonium hydrogen phosphate, 1,6-hexanediol, BIS-TRIS	Resolution 2.90 Å R-free 0.302
9WQK GRM5-Gi Complex Structure Deposited 2025-09-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain X 21–839（819 aa） Chain Y 21–839（819 aa）	Not recorded	YKU 3-cyano-N-(1,3-diphenyl-1H-pyrazol-5-yl)benzamide × 1 GGL GAMMA-L-GLUTAMIC ACID × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8 CL CHLORIDE ION × 2 CLR CHOLESTEROL × 8	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å
9WQL GRM5-Gq Complex Structure Deposited 2025-09-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain X 21–839（819 aa） Chain Y 21–839（819 aa）	Not recorded	YKU 3-cyano-N-(1,3-diphenyl-1H-pyrazol-5-yl)benzamide × 1 GGL GAMMA-L-GLUTAMIC ACID × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8 CL CHLORIDE ION × 2 CLR CHOLESTEROL × 7	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å

28 other PDB entries and 33 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	GRM5_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 25–881； UniProt 20–876 Author chain B； PDBConstruct 25–881； UniProt 20–876

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8t7h
Deposition date deposition_date	2023-06-20
Structure title title	Quis-bound intermediate mGlu5
Keywords keywords	GPCR, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	59.60 Å
Radius of gyration Rg (electron density) rg_electron	60.89 Å
Forward intensity I(0) i0	523435000.00
Molecular weight molecular_weight	186350.0 kDa
Excluded volume excluded_volume	231050 Å³
Envelope volume envelope_volume	376280 Å³
Hydration-shell volume shell_volume	56329 Å³
Envelope diameter envelope_diameter	208.3 Å
Shell Rg shell_rg	54.93 Å
Envelope Rg envelope_rg	60.76 Å
Shape Rg shape_rg	61.02 Å
Total Rg total_rg	60.28 Å
Total atoms total_atoms	13100
Residues n_residues	1794
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	196.9 Å
Rg (real space) rg_real	60.58 Å
Rg uncertainty (real space) rg_real_error	2.01 Å
I(0) (real space) i0_real	5.2340e+08
I(0) uncertainty (real space) i0_real_error	1.0970e+07
Rg (reciprocal space) rg_reciprocal	58.73 Å
I(0) (reciprocal space) i0_reciprocal	521900000.0000
Solution quality estimate total_estimate	0.7532
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	53.0 Å
Skewness Skewness skewness	0.564
Kurtosis Kurtosis kurtosis	-0.550
Angular range angular_range	— – 0.1300 Å⁻¹
Current regularization parameter α current_alpha	0.0001
Highest regularization parameter α highest_alpha	17250000.0000
Real-space data points n_real_points	27
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.645; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.821; Smooth: 0.032

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Metabotropic glutamate receptor 5
Molecular weight formula_weight	98868.3 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	13100

MKTIIALSYIFCLVFADYKDDDDAAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFLLLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQHRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCPGYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFDYINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVVFIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETL

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Spodoptera frugiperda

Entity 2 Entity 2 polymer

Description description	Nanobody 43
Molecular weight formula_weight	13354.7 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

QVQLVESGGGLVQAGGSLRLSCAASGRTFTSYAMGWFRQAPGKERESVAAISSSGGSTHYADSVKGRFTISRDNSKNTVYLQMNSLKPEDTAVYYCAAAMYGSRWPDWEYDYWGQGTQVTVSS

来源 Source

来源生物 organism	Lama glama
NCBI Class编号 ncbi_taxonomy_id	9844
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	(S)-2-AMINO-3-(3,5-DIOXO-[1,2,4]OXADIAZOLIDIN-2-YL)-PROPIONIC ACID
Molecular weight formula_weight	189.1 kDa
Source method src_method	syn
Copy count entity_count	2

▶

8. Citations (2)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.30 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	211019

fit	/app/data/saxs_computation/t7/8t7h/8t7h.fit
pddf	/app/data/pr_computation/t7/8t7h/8t7h.pr.out
profile	/app/data/saxs_computation/t7/8t7h/8t7h.dat

Quis-bound intermediate mGlu5

1. Protein Identity and Related Structures Protein Identity & Related Structures

Metabotropic glutamate receptor 5

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

8. Citations (2)

9. Files and Curves (10)

Files (7)

Curves (3)