SAXSdb — 8tea

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Envelope protein UL128

Human betaherpesvirus 5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Envelope glycoprotein UL130 × 1 （A0A0G2TB82） UL131A × 1 （Q38M12） CS2pt1p2_A10L Fab light chain × 1 CS2pt1p2_A10L Fab heavy chain × 1 CS3pt1p4_C1L Fab heavy chain × 1 CS3pt1p4_C1L Fab light chain × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q38LY2_HCMV
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain C； PDBConstruct 20–163； UniProt 28–171

Envelope glycoprotein UL130

Human betaherpesvirus 5

UniProt A0A0G2TB82

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Envelope protein UL128 × 1 （Q38LY2） UL131A × 1 （Q38M12） CS2pt1p2_A10L Fab light chain × 1 CS2pt1p2_A10L Fab heavy chain × 1 CS3pt1p4_C1L Fab heavy chain × 1 CS3pt1p4_C1L Fab light chain × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0G2TB82_HCMV
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 20–208； UniProt 26–214

UL131A

Human betaherpesvirus 5

UniProt Q38M12

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 7	Envelope protein UL128 × 1 （Q38LY2） Envelope glycoprotein UL130 × 1 （A0A0G2TB82） CS2pt1p2_A10L Fab light chain × 1 CS2pt1p2_A10L Fab heavy chain × 1 CS3pt1p4_C1L Fab heavy chain × 1 CS3pt1p4_C1L Fab light chain × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q38M12_HCMV
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 20–130； UniProt 19–129

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8tea
Deposition date deposition_date	2023-07-05
Structure title title	HCMV Pentamer in complex with CS2pt1p2_A10L Fab and CS3pt1p4_C1L Fab
Keywords keywords	Virus, glycoprotein, antibody, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8tea__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8tea__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8tea__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	34.54 Å
Rg (electron density)	34.41 Å
Total Rg	34.77 Å
Atom count	6054
Residues	780
Excluded volume	106660 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8tea__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Envelope protein UL128
Molecular weight formula_weight	18940.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C
Atom count atom_count	6054

MEWSWVFLFFLSVTTGVHSEECCEFINVNHPPERCYDFKMCNRFTVALRCPDGEVCYSPEKTAEIRGIVTTMTHSLTRQVVHNKLTSCNYNPLYLEADGRIRCGKVNDKAQYLLGAAGSVPYRWINLEYDKITRIVGLDQYLESVKKHKRLDVCRAKMGYMLQ

Source Source

Source organism organism	Human betaherpesvirus 5
NCBI taxonomy ID ncbi_taxonomy_id	10359
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Envelope glycoprotein UL130
Molecular weight formula_weight	24018.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MEWSWVFLFFLSVTTGVHSSPWSTLTANQNPSPPWSKLTYSKPHDAATFYCPFLYPSPPRSPLQFSGFQQVSTGPECRNETLYLLYNREGQTLVERSSTWVKKVIWYLSGRNQTILQRMPQTASKPSDGNVQISVEDAKIFGAHMVPKQTKLLRFVVNDGTRYQMCVMKLESWAHVFRDYSVSFQVRLTFTEANNQTYTFCTHPNLIV

Source Source

Source organism organism	Human betaherpesvirus 5
NCBI taxonomy ID ncbi_taxonomy_id	10359
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	UL131A
Molecular weight formula_weight	15262.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MEWSWVFLFFLSVTTGVHSQCQRETAEKNDYYRVPHYWDACSRALPDQTRYKYVEQLVDLTLNYHYDASHGLDNFDVLKRINVTEVSLLISDFRRQNRRGGTNKRTTFNAAGSLAPHARSLEFSVRLFAN

Source Source

Source organism organism	Human betaherpesvirus 5
NCBI taxonomy ID ncbi_taxonomy_id	10359
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	CS2pt1p2_A10L Fab light chain
Molecular weight formula_weight	22850.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

QSALTQPPSASGTPGQRVTISCSGSSSNIGSNTVHWYQQLPGTAPKLLIYSNNQRPSGVPDRFSGSRSGTSASLAISGLRSEDEADYYCAAWDDSLNGRVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 5 Entity 5 polymer

Description description	CS2pt1p2_A10L Fab heavy chain
Molecular weight formula_weight	25916.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MEFGLSWVFLVALIKGVQCQVHLEESGGGLVKPGGSLRLSCVASGFSFSDYYMSWIRQAPGKGLEWLSYISPSGSPTSNADSMKGRFTISRDNARSSLYLQVHSLRVEDTAVYYCARDNTVFGVVTTPMDHWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	CS3pt1p4_C1L Fab heavy chain
Molecular weight formula_weight	23630.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

QVQLVQSGAEVKKPGSSVKVSCKASGGTFTDYALSWVRQAPGQGLEWMGGIIPVLGTPHYAQKFEDRVTIIADESTGTVFMALSSLRSDDTGMYYCARGVTHPYYYYAMDVWGQGTTITVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 7 Entity 7 polymer

Description description	CS3pt1p4_C1L Fab light chain
Molecular weight formula_weight	23239.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

QSALTQPASVSGSPGQSISISCTGTSSDVGAYDYVSWYQQHPGKAPRLIIYDVNKRPSGVPYRFSGSKSGTAASLTISGLQSEDEAVYYCGSYTSSSAFFYVFGTGTMVTVLRQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

▼

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	8teaF01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	8teaG01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	8teaI01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	71677

HCMV Pentamer in complex with CS2pt1p2_A10L Fab and CS3pt1p4_C1L Fab

1. Protein Identity and Related Structures Protein Identity & Related Structures

Envelope protein UL128

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Envelope glycoprotein UL130

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

UL131A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8tea__assembly_1__model_1

8tea__assembly_1__model_1 | I(q)

8tea__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

Entity 7 Entity 7 polymer

Polymer Polymer

Source Source

6. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

7. Citations (1)