8tk7

Myxococcus xanthus EncA protein shell with compartmentalized SNAP-tag cargo protein

Method: ELECTRON MICROSCOPY D_max: 130.3 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Type 1 encapsulin shell protein EncA

Myxococcus xanthus DK 1622

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 360 PDB declaration: 360-meric（360） Consistent with protein copy count	Chain A； UniProt 1–287 Chain B； UniProt 1–287 Chain C； UniProt 1–287	Not recorded	Methylated-DNA--protein-cysteine methyltransferase × 180 （E5BBQ0）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.53 Å
2	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 1–287 Chain B； UniProt 1–287 Chain C； UniProt 1–287	Not recorded	Methylated-DNA--protein-cysteine methyltransferase × 3 （E5BBQ0）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.53 Å
3	Protein heterocomplex Heteromer Protein × 30 PDB declaration: 30-meric（30） Consistent with protein copy count	Chain A； UniProt 1–287 Chain B； UniProt 1–287 Chain C； UniProt 1–287	Not recorded	Methylated-DNA--protein-cysteine methyltransferase × 15 （E5BBQ0）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.53 Å
4	Protein heterocomplex Heteromer Protein × 36 PDB declaration: 36-meric（36） Consistent with protein copy count	Chain A； UniProt 1–287 Chain B； UniProt 1–287 Chain C； UniProt 1–287	Not recorded	Methylated-DNA--protein-cysteine methyltransferase × 18 （E5BBQ0）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.53 Å
5	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 1–287 Chain B； UniProt 1–287 Chain C； UniProt 1–287	Not recorded	Methylated-DNA--protein-cysteine methyltransferase × 3 （E5BBQ0）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.53 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 8TK7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
4PT2 Myxococcus xanthus encapsulin protein (EncA) Deposited 2014-03-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 180-MERIC	Chain A 8–294（287 aa） Fragment：UNP residues 8-294 Chain B 8–294（287 aa） Fragment：UNP residues 8-294 Chain P 8–294（287 aa） Fragment：UNP residues 8-294	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 10 mM Tris, 10 mM MgCl2；pH 7.6；10 mM Tris, 10 mM MgCl2 cryo-EM vitrification conditions 83 K；Cryogen ETHANE；Plunged into liquid ethane (LEICA KF80)	Resolution 4.60 Å
4PT2 Myxococcus xanthus encapsulin protein (EncA) Deposited 2014-03-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 8–294（287 aa） Fragment：UNP residues 8-294 Chain B 8–294（287 aa） Fragment：UNP residues 8-294 Chain P 8–294（287 aa） Fragment：UNP residues 8-294	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 10 mM Tris, 10 mM MgCl2；pH 7.6；10 mM Tris, 10 mM MgCl2 cryo-EM vitrification conditions 83 K；Cryogen ETHANE；Plunged into liquid ethane (LEICA KF80)	Resolution 4.60 Å
4PT2 Myxococcus xanthus encapsulin protein (EncA) Deposited 2014-03-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 15 PDB declaration: pentadecameric	Chain A 8–294（287 aa） Fragment：UNP residues 8-294 Chain B 8–294（287 aa） Fragment：UNP residues 8-294 Chain P 8–294（287 aa） Fragment：UNP residues 8-294	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 10 mM Tris, 10 mM MgCl2；pH 7.6；10 mM Tris, 10 mM MgCl2 cryo-EM vitrification conditions 83 K；Cryogen ETHANE；Plunged into liquid ethane (LEICA KF80)	Resolution 4.60 Å
4PT2 Myxococcus xanthus encapsulin protein (EncA) Deposited 2014-03-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 18 PDB declaration: octadecameric	Chain A 8–294（287 aa） Fragment：UNP residues 8-294 Chain B 8–294（287 aa） Fragment：UNP residues 8-294 Chain P 8–294（287 aa） Fragment：UNP residues 8-294	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 10 mM Tris, 10 mM MgCl2；pH 7.6；10 mM Tris, 10 mM MgCl2 cryo-EM vitrification conditions 83 K；Cryogen ETHANE；Plunged into liquid ethane (LEICA KF80)	Resolution 4.60 Å
4PT2 Myxococcus xanthus encapsulin protein (EncA) Deposited 2014-03-10	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 8–294（287 aa） Fragment：UNP residues 8-294 Chain B 8–294（287 aa） Fragment：UNP residues 8-294 Chain P 8–294（287 aa） Fragment：UNP residues 8-294	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 10 mM Tris, 10 mM MgCl2；pH 7.6；10 mM Tris, 10 mM MgCl2 cryo-EM vitrification conditions 83 K；Cryogen ETHANE；Plunged into liquid ethane (LEICA KF80)	Resolution 4.60 Å
7S20 M. xanthus encapsulin shell protein EncA with T=3 symmetry Deposited 2021-09-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 180-meric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7S20 M. xanthus encapsulin shell protein EncA with T=3 symmetry Deposited 2021-09-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7S20 M. xanthus encapsulin shell protein EncA with T=3 symmetry Deposited 2021-09-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 15 PDB declaration: pentadecameric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7S20 M. xanthus encapsulin shell protein EncA with T=3 symmetry Deposited 2021-09-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 18 PDB declaration: octadecameric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7S20 M. xanthus encapsulin shell protein EncA with T=3 symmetry Deposited 2021-09-02	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7S21 M. xanthus encapsulin shell protein EncA with T=1 symmetry Deposited 2021-09-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 60 PDB declaration: 60-meric	Chain A 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7S21 M. xanthus encapsulin shell protein EncA with T=1 symmetry Deposited 2021-09-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7S21 M. xanthus encapsulin shell protein EncA with T=1 symmetry Deposited 2021-09-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7S21 M. xanthus encapsulin shell protein EncA with T=1 symmetry Deposited 2021-09-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7S21 M. xanthus encapsulin shell protein EncA with T=1 symmetry Deposited 2021-09-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
7S2T M. xanthus encapsulin EncA bound to EncB targeting peptide Deposited 2021-09-03	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.45 Å
7S2T M. xanthus encapsulin EncA bound to EncB targeting peptide Deposited 2021-09-03	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.45 Å
7S2T M. xanthus encapsulin EncA bound to EncB targeting peptide Deposited 2021-09-03	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.45 Å
7S2T M. xanthus encapsulin EncA bound to EncB targeting peptide Deposited 2021-09-03	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.45 Å
7S2T M. xanthus encapsulin EncA bound to EncB targeting peptide Deposited 2021-09-03	Different construct Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.45 Å
7S4Q M. xanthus encapsulin EncA bound to EncC targeting peptide Deposited 2021-09-09	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
7S4Q M. xanthus encapsulin EncA bound to EncC targeting peptide Deposited 2021-09-09	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
7S4Q M. xanthus encapsulin EncA bound to EncC targeting peptide Deposited 2021-09-09	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
7S4Q M. xanthus encapsulin EncA bound to EncC targeting peptide Deposited 2021-09-09	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
7S4Q M. xanthus encapsulin EncA bound to EncC targeting peptide Deposited 2021-09-09	Different construct Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20 mM HEPES, pH 7.3, 150 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.12 Å
8V4N Myxococcus xanthus EncA 3xHis pore mutant with T=1 icosahedral symmetry Deposited 2023-11-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–287（287 aa）	Mutation：K199H, T200H, G201H	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；50 mM Tris pH 8.0, 200 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 5 Blot time: 2 seconds	Resolution 2.43 Å
8V4Q Myxococcus xanthus EncA 3xHis pore mutant with tetrahedral symmetry Deposited 2023-11-29	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 1–287（287 aa） Chain B 1–287（287 aa） Chain C 1–287（287 aa）	Mutation：K199H, T200H, G201H Mutation：K199H, T200H, G201H Mutation：K199H, T200H, G201H	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 8；50 mM Tris pH 8.0, 200 mM NaCl cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 5 Blot time: 2 seconds	Resolution 2.71 Å
8VJO Cryo-EM structure of Myxococcus xanthus EncA encapsulin shell loaded with EncD cargo Deposited 2024-01-07	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20mM HEPES, 150mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å
8VJO Cryo-EM structure of Myxococcus xanthus EncA encapsulin shell loaded with EncD cargo Deposited 2024-01-07	Different construct Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20mM HEPES, 150mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å
8VJO Cryo-EM structure of Myxococcus xanthus EncA encapsulin shell loaded with EncD cargo Deposited 2024-01-07	Different construct Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20mM HEPES, 150mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å
8VJO Cryo-EM structure of Myxococcus xanthus EncA encapsulin shell loaded with EncD cargo Deposited 2024-01-07	Different construct Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20mM HEPES, 150mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å
8VJO Cryo-EM structure of Myxococcus xanthus EncA encapsulin shell loaded with EncD cargo Deposited 2024-01-07	Different construct Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–294（294 aa） Chain B 1–294（294 aa） Chain C 1–294（294 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.3；20mM HEPES, 150mM NaCl cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.40 Å
9B9I Myxococcus xanthus EncA encapsulin engineered pore mutant with T=1 icosahedral symmetry Deposited 2024-04-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 60 PDB declaration: 60-meric	Chain A 1–287（287 aa） Fragment：I203G, Y204G, del(205-210)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 20 Blot time: 4 seconds Wait time: 0 seconds	Resolution 2.86 Å
9B9I Myxococcus xanthus EncA encapsulin engineered pore mutant with T=1 icosahedral symmetry Deposited 2024-04-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–287（287 aa） Fragment：I203G, Y204G, del(205-210)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 20 Blot time: 4 seconds Wait time: 0 seconds	Resolution 2.86 Å
9B9I Myxococcus xanthus EncA encapsulin engineered pore mutant with T=1 icosahedral symmetry Deposited 2024-04-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 5 PDB declaration: pentameric	Chain A 1–287（287 aa） Fragment：I203G, Y204G, del(205-210)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 20 Blot time: 4 seconds Wait time: 0 seconds	Resolution 2.86 Å
9B9I Myxococcus xanthus EncA encapsulin engineered pore mutant with T=1 icosahedral symmetry Deposited 2024-04-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–287（287 aa） Fragment：I203G, Y204G, del(205-210)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 20 Blot time: 4 seconds Wait time: 0 seconds	Resolution 2.86 Å
9B9I Myxococcus xanthus EncA encapsulin engineered pore mutant with T=1 icosahedral symmetry Deposited 2024-04-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–287（287 aa） Fragment：I203G, Y204G, del(205-210)	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 20 Blot time: 4 seconds Wait time: 0 seconds	Resolution 2.86 Å
9B9Q Cargo-loaded Myxococcus xanthus EncA encapsulin engineered pore mutant with T=3 icosahedral symmetry Deposited 2024-04-03	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain A 1–287（287 aa） Chain B 1–287（287 aa） Chain C 1–287（287 aa）	Mutation：I203G, Y204G, del(205-210) Mutation：I203G, Y204G, del(205-210) Mutation：I203G, Y204G, del(205-210)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 20 Blot time: 4 seconds Wait time: 0 seconds	Resolution 3.14 Å
9B9Q Cargo-loaded Myxococcus xanthus EncA encapsulin engineered pore mutant with T=3 icosahedral symmetry Deposited 2024-04-03	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–287（287 aa） Chain B 1–287（287 aa） Chain C 1–287（287 aa）	Mutation：I203G, Y204G, del(205-210) Mutation：I203G, Y204G, del(205-210) Mutation：I203G, Y204G, del(205-210)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 20 Blot time: 4 seconds Wait time: 0 seconds	Resolution 3.14 Å
9B9Q Cargo-loaded Myxococcus xanthus EncA encapsulin engineered pore mutant with T=3 icosahedral symmetry Deposited 2024-04-03	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain A 1–287（287 aa） Chain B 1–287（287 aa） Chain C 1–287（287 aa）	Mutation：I203G, Y204G, del(205-210) Mutation：I203G, Y204G, del(205-210) Mutation：I203G, Y204G, del(205-210)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 20 Blot time: 4 seconds Wait time: 0 seconds	Resolution 3.14 Å
9B9Q Cargo-loaded Myxococcus xanthus EncA encapsulin engineered pore mutant with T=3 icosahedral symmetry Deposited 2024-04-03	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain A 1–287（287 aa） Chain B 1–287（287 aa） Chain C 1–287（287 aa）	Mutation：I203G, Y204G, del(205-210) Mutation：I203G, Y204G, del(205-210) Mutation：I203G, Y204G, del(205-210)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 20 Blot time: 4 seconds Wait time: 0 seconds	Resolution 3.14 Å
9B9Q Cargo-loaded Myxococcus xanthus EncA encapsulin engineered pore mutant with T=3 icosahedral symmetry Deposited 2024-04-03	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 1–287（287 aa） Chain B 1–287（287 aa） Chain C 1–287（287 aa）	Mutation：I203G, Y204G, del(205-210) Mutation：I203G, Y204G, del(205-210) Mutation：I203G, Y204G, del(205-210)	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 20 Blot time: 4 seconds Wait time: 0 seconds	Resolution 3.14 Å
9BC8 Cargo-loaded Myxococcus xanthus EncA encapsulin engineered pore mutant with T=4 icosahedral symmetry Deposited 2024-04-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 480 PDB declaration: 480-meric	Chain A 1–287（287 aa） Chain B 1–287（287 aa） Chain C 1–287（287 aa） Chain D 1–287（287 aa）	Mutation：I203G, Y204G Mutation：I203G, Y204G Mutation：I203G, Y204G Mutation：I203G, Y204G	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 20 Blot time: 4 seconds Wait time: 0 seconds	Resolution 3.46 Å
9BC8 Cargo-loaded Myxococcus xanthus EncA encapsulin engineered pore mutant with T=4 icosahedral symmetry Deposited 2024-04-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–287（287 aa） Chain B 1–287（287 aa） Chain C 1–287（287 aa） Chain D 1–287（287 aa）	Mutation：I203G, Y204G Mutation：I203G, Y204G Mutation：I203G, Y204G Mutation：I203G, Y204G	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 20 Blot time: 4 seconds Wait time: 0 seconds	Resolution 3.46 Å
9BC8 Cargo-loaded Myxococcus xanthus EncA encapsulin engineered pore mutant with T=4 icosahedral symmetry Deposited 2024-04-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 40 PDB declaration: 40-meric	Chain A 1–287（287 aa） Chain B 1–287（287 aa） Chain C 1–287（287 aa） Chain D 1–287（287 aa）	Mutation：I203G, Y204G Mutation：I203G, Y204G Mutation：I203G, Y204G Mutation：I203G, Y204G	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 20 Blot time: 4 seconds Wait time: 0 seconds	Resolution 3.46 Å
9BC8 Cargo-loaded Myxococcus xanthus EncA encapsulin engineered pore mutant with T=4 icosahedral symmetry Deposited 2024-04-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 48 PDB declaration: 48-meric	Chain A 1–287（287 aa） Chain B 1–287（287 aa） Chain C 1–287（287 aa） Chain D 1–287（287 aa）	Mutation：I203G, Y204G Mutation：I203G, Y204G Mutation：I203G, Y204G Mutation：I203G, Y204G	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 20 Blot time: 4 seconds Wait time: 0 seconds	Resolution 3.46 Å
9BC8 Cargo-loaded Myxococcus xanthus EncA encapsulin engineered pore mutant with T=4 icosahedral symmetry Deposited 2024-04-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain A 1–287（287 aa） Chain B 1–287（287 aa） Chain C 1–287（287 aa） Chain D 1–287（287 aa）	Mutation：I203G, Y204G Mutation：I203G, Y204G Mutation：I203G, Y204G Mutation：I203G, Y204G	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE；Blot force: 20 Blot time: 4 seconds Wait time: 0 seconds	Resolution 3.46 Å

11 other PDB entries and 47 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	ENCAP_MYXXD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–287； UniProt 1–287 Author chain B； PDBConstruct 1–287； UniProt 1–287 Author chain C； PDBConstruct 1–287； UniProt 1–287

Methylated-DNA--protein-cysteine methyltransferase

Homo sapiens

UniProt E5BBQ0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 360 PDB declaration: 360-meric（360） Consistent with protein copy count	Chain D； UniProt 1–182 Chain E； UniProt 1–182 Chain F； UniProt 1–182	Not recorded	Type 1 encapsulin shell protein EncA × 180 （Q1D6H4）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.53 Å
2	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain D； UniProt 1–182 Chain E； UniProt 1–182 Chain F； UniProt 1–182	Not recorded	Type 1 encapsulin shell protein EncA × 3 （Q1D6H4）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.53 Å
3	Protein heterocomplex Heteromer Protein × 30 PDB declaration: 30-meric（30） Consistent with protein copy count	Chain D； UniProt 1–182 Chain E； UniProt 1–182 Chain F； UniProt 1–182	Not recorded	Type 1 encapsulin shell protein EncA × 15 （Q1D6H4）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.53 Å
4	Protein heterocomplex Heteromer Protein × 36 PDB declaration: 36-meric（36） Consistent with protein copy count	Chain D； UniProt 1–182 Chain E； UniProt 1–182 Chain F； UniProt 1–182	Not recorded	Type 1 encapsulin shell protein EncA × 18 （Q1D6H4）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.53 Å
5	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain D； UniProt 1–182 Chain E； UniProt 1–182 Chain F； UniProt 1–182	Not recorded	Type 1 encapsulin shell protein EncA × 3 （Q1D6H4）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.5；150 mM NaCl, 20 mM Tris pH 7.5 cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 2.53 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 8TK7	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
3KZY Crystal structure of SNAP-tag Deposited 2009-12-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–182（182 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；34% PEG 3350, 100mM BisTris pH 5.5, 500mM NaCl , VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.90 Å R-free 0.261
3KZY Crystal structure of SNAP-tag Deposited 2009-12-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–182（182 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；291 K；34% PEG 3350, 100mM BisTris pH 5.5, 500mM NaCl , VAPOR DIFFUSION, HANGING DROP, temperature 291K	Resolution 1.90 Å R-free 0.261
6RLA Structure of the dynein-2 complex; motor domains Deposited 2019-05-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 5–181（177 aa） Chain B 5–181（177 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6RLB Structure of the dynein-2 complex; tail domain Deposited 2019-05-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain A 5–181（177 aa） Chain B 5–181（177 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.50 Å
6SC2 Structure of the dynein-2 complex; IFT-train bound model Deposited 2019-07-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain A 5–181（177 aa） Chain B 5–181（177 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 6 ATP ADENOSINE-5'-TRIPHOSPHATE × 2 MG MAGNESIUM ION × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6Y8P Crystal structure of SNAP-tag labeled with a benzyl-tetramethylrhodamine fluorophore Deposited 2020-03-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 7–182（176 aa）	Not recorded	ZN ZINC ION × 1 OGQ [9-[2-carboxy-5-[(4-methylphenyl)methylcarbamoyl]phenyl]-6-(dimethylamino)xanthen-3-ylidene]-dimethyl-azanium × 1 EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；291 K；100 mM Na HEPES pH 7.5 25% PEG 8000 10 mg/mL protein 100 nl:100 nL	Resolution 2.30 Å R-free 0.277
8DD7 The Cryo-EM structure of Drosophila Cryptochrome in complex with Timeless Deposited 2022-06-17	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–181（181 aa） Chain B 5–181（177 aa）	Not recorded	FAD FLAVIN-ADENINE DINUCLEOTIDE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE	Resolution 3.30 Å
9DI0 Cryo-EM structure of Kif18A bound to a microtubule Deposited 2024-09-04	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 5–181（177 aa）	Not recorded	ADP ADENOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 2 TA1 TAXOL × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 6.9 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å

7 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	E5BBQ0_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 2–183； UniProt 1–182 Author chain E； PDBConstruct 2–183； UniProt 1–182 Author chain F； PDBConstruct 2–183； UniProt 1–182

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8tk7
Deposition date deposition_date	2023-07-25
Structure title title	Myxococcus xanthus EncA protein shell with compartmentalized SNAP-tag cargo protein
Keywords keywords	Encapsulin, nanocompartment, VIRUS LIKE PARTICLE; VIRUS LIKE PARTICLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	36.49 Å
Radius of gyration Rg (electron density) rg_electron	36.15 Å
Forward intensity I(0) i0	142716000.00
Molecular weight molecular_weight	95146.0 kDa
Excluded volume excluded_volume	119000 Å³
Envelope volume envelope_volume	167820 Å³
Hydration-shell volume shell_volume	40398 Å³
Envelope diameter envelope_diameter	142.6 Å
Shell Rg shell_rg	40.22 Å
Envelope Rg envelope_rg	36.49 Å
Shape Rg shape_rg	36.16 Å
Total Rg total_rg	36.40 Å
Total atoms total_atoms	6702
Residues n_residues	861
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	130.3 Å
Rg (real space) rg_real	36.56 Å
Rg uncertainty (real space) rg_real_error	1.03 Å
I(0) (real space) i0_real	1.4270e+08
I(0) uncertainty (real space) i0_real_error	2.2690e+06
Rg (reciprocal space) rg_reciprocal	36.52 Å
I(0) (reciprocal space) i0_reciprocal	142700000.0000
Solution quality estimate total_estimate	0.8655
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	42.4 Å
Skewness Skewness skewness	0.339
Kurtosis Kurtosis kurtosis	-0.376
Angular range angular_range	— – 0.2150 Å⁻¹
Current regularization parameter α current_alpha	0.0002
Highest regularization parameter α highest_alpha	24950000.0000
Real-space data points n_real_points	44
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.805; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.842; Smooth: 0.989

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Type 1 encapsulin shell protein EncA
Molecular weight formula_weight	31692.0 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,A,C
Atom count atom_count	6702

MPDFLGHAENPLREEEWARLNETVIQVARRSLVGRRILDIYGPLGAGVQTVPYDEFQGVSPGAVDIVGEQETAMVFTDARKFKTIPIIYKDFLLHWRDIEAARTHNMPLDVSAAAGAAALCAQQEDELIFYGDARLGYEGLMTANGRLTVPLGDWTSPGGGFQAIVEATRKLNEQGHFGPYAVVLSPRLYSQLHRIYEKTGVLEIETIRQLASDGVYQSNRLRGESGVVVSTGRENMDLAVSMDMVAAYLGASRMNHPFRVLEALLLRIKHPDAICTLEGAGATERR

来源 Source

来源生物 organism	Myxococcus xanthus DK 1622
NCBI Class编号 ncbi_taxonomy_id	246197
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	Methylated-DNA--protein-cysteine methyltransferase
Molecular weight formula_weight	21482.6 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,D,F

MGPGSDKDCEMKRTTLDSPLGKLELSGCEQGLHEIIFLGKGTSAADAVEVPAPAAVLGGPEPLMQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYSHLAALAGNPAATAAVKTALSGNPVPILIPCHRVVQGDLDVGGYEGGLAVKEWLLAHEGHRLGKRGGGSGGGSPEKRLTVGSLRR

来源 Source

来源生物 organism	Homo sapiens
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

▼

7. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

Domain ID domain_id	8tk7A01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2320 — hypothetical protein PF0899 fold
Homologous superfamily homologous superfamily	10 — hypothetical protein PF0899 domain

Domain ID domain_id	8tk7B01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2320 — hypothetical protein PF0899 fold
Homologous superfamily homologous superfamily	10 — hypothetical protein PF0899 domain

Domain ID domain_id	8tk7C01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	2320 — hypothetical protein PF0899 fold
Homologous superfamily homologous superfamily	10 — hypothetical protein PF0899 domain

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.53 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	50680

fit	/app/data/saxs_computation/tk/8tk7/8tk7.fit
pddf	/app/data/pr_computation/tk/8tk7/8tk7.pr.out
profile	/app/data/saxs_computation/tk/8tk7/8tk7.dat

Myxococcus xanthus EncA protein shell with compartmentalized SNAP-tag cargo protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Type 1 encapsulin shell protein EncA

State in the Current Structure

Other States of the Same Protein in the Database

Methylated-DNA--protein-cysteine methyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

7. Fold Classification (SCOP + CATH) 3 domains

CATH v4.4 (3 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)