SAXSdb — 8tm8

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Monellin chain B,Monellin chain A

Dioscoreophyllum cumminsii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	SODIUM ION × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MONA_DIOCU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 50–91； UniProt 4–45 Author chain B； PDBConstruct 50–91； UniProt 4–45

Monellin chain B,Monellin chain A

Dioscoreophyllum cumminsii

UniProt P02882

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	water × 1	Consistent with protein count
2	Insufficient information	Monomer	Protein 1	SODIUM ION × 2 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MONB_DIOCU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 2–49； UniProt 1–48 Author chain B； PDBConstruct 2–49； UniProt 1–48

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8tm8
Deposition date deposition_date	2023-07-28
Last revision last_revision	2024-12-18
Structure title title	Monomer structure of monellin loop1 mutant (YENKG)
Keywords keywords	single-chain Monellin, Sweet protein, domain swapping, PLANT PROTEIN; PLANT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8tm8__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8tm8__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8tm8__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	13.59 Å
Rg (electron density)	12.13 Å
Total Rg	13.52 Å
Atom count	1351
Residues	85
Excluded volume	12289 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8tm8__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8tm8__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Monellin chain B,Monellin chain A
Molecular weight formula_weight	10686.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2913

MGEWEIIDIGPFTQNLGKFAVDEENKIGQYGRLTFNKVIRPCMKKTIYENKGYEYQLYVYASDKLFRADISEDYKTRGRKLLRFNGPVPPP

Source Source

Source organism organism	Dioscoreophyllum cumminsii
Common name common_name	serendipity berry
NCBI taxonomy ID ncbi_taxonomy_id	3457
Host organism host_organism	Escherichia coli BL21

Entity 2 Entity 2 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	55

▶

Unit-cell length a length_a	29.139 Å
Unit-cell length b length_b	58.789 Å
Unit-cell length c length_c	45.210 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	91.91 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.260 Å
Low-resolution limit resolution_low	45.180 Å
R factor r_factor	0.1986
R_work r_work	0.1916
R_free r_free	0.2608

Monomer structure of monellin loop1 mutant (YENKG)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Monellin chain B,Monellin chain A

State in the Current Structure

Other States of the Same Protein in the Database

Monellin chain B,Monellin chain A

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8tm8__assembly_2__model_1

8tm8__assembly_2__model_1 | I(q)

8tm8__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)

Monomer structure of monellin loop1 mutant (YENKG)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Monellin chain B,Monellin chain A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Monellin chain B,Monellin chain A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8tm8__assembly_2__model_1

8tm8__assembly_2__model_1 | I(q)

8tm8__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)