SAXSdb — 8tuw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Maturation protein A

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Type IV major pilin protein PilA × 16 （P04739）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MATA_BPPP7
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain M1； PDBConstruct 1–448； UniProt 2–449

Type IV major pilin protein PilA

Pseudomonas aeruginosa PAO1

UniProt P04739

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 17	Maturation protein A × 1 （Q38061）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PILA_PSEAE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain a2； PDBConstruct 1–143； UniProt 7–149 Author chain b2； PDBConstruct 1–143； UniProt 7–149 Author chain c2； PDBConstruct 1–143； UniProt 7–149 Author chain d2； PDBConstruct 1–143； UniProt 7–149 Author chain e2； PDBConstruct 1–143； UniProt 7–149 Author chain f2； PDBConstruct 1–143； UniProt 7–149 Author chain g2； PDBConstruct 1–143； UniProt 7–149 Author chain h2； PDBConstruct 1–143； UniProt 7–149 Author chain i2； PDBConstruct 1–143； UniProt 7–149 Author chain j2； PDBConstruct 1–143； UniProt 7–149 Author chain k2； PDBConstruct 1–143； UniProt 7–149 Author chain l2； PDBConstruct 1–143； UniProt 7–149 Author chain m2； PDBConstruct 1–143； UniProt 7–149 Author chain n2； PDBConstruct 1–143； UniProt 7–149 Author chain o2； PDBConstruct 1–143； UniProt 7–149 Author chain p2； PDBConstruct 1–143； UniProt 7–149

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8tuw
Deposition date deposition_date	2023-08-17
Structure title title	Type IV pilus from Pseudomonas PAO1 strain with PP7 Maturation protein
Keywords keywords	Type IV pilus, T4P, PAO1, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8tuw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8tuw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8tuw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	61.09 Å
Rg (electron density)	62.79 Å
Total Rg	62.50 Å
Atom count	40791
Residues	2736
Excluded volume	363490 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8tuw__assembly_1__model_1`	heptadecameric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Maturation protein A
Molecular weight formula_weight	50763.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M1
Atom count atom_count	40791

LEEHYYSRKTCGSGGGLSVQRTGYPQTDPPVFKAVNSFERAPLIVGDHVHSLPYWSRKITLECTPYPFTLRWEGGVHKDGIPDKVPHPSCDPGSELVSYTHSREVDCERFIGPVPSSFTDPKVTSAQWKFLEDMADMKALADLNKSLVNLPMLYKERRETLKMVGNRLGGLVRVAHAAQDRDLKRYFKARRKDRRKVAEEVANGHLELIFGWLPLIGELEGAIEYAELPDLDFIRCHGLHTLVLQSTPWDNSVDVRSYPNWERAAGTRITGSVRTRGVVESRASVRTALRFNLETSLAGDARRLGFEPISTTYDMIPLSFVVGWFSNFDKYVRTLAPLIGVTFETGSQNRRTTCELVGCTRFYPRTVSPPSGWFARWKDFPDGSLSEVSGLRRTDIRSVLSTLPDPDVRFHADVGLFEISAGISLLAQRYLKPLQRLLKRKSFFYGRT

Entity 2 Entity 2 polymer

Description description	Type IV major pilin protein PilA
Molecular weight formula_weight	14878.9 kDa
Source method src_method	man
Copy count entity_count	16

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a2,b2,c2,d2,e2,f2,g2,h2,i2,j2,k2,l2,m2,n2,o2,p2

FTLIELMIVVAIIGILAAIAIPQYQNYVARSEGASALATINPLKTTVEESLSRGIAGSKIKIGTTASTATETYVGVEPDANKLGVIAVAIEDSGAGDITFTFQTGTSSPKNATKVITLNRTADGVWACKSTQDPMFTPKGCDN

Source Source

Source organism organism	Pseudomonas aeruginosa PAO1
NCBI taxonomy ID ncbi_taxonomy_id	208964
Host organism host_organism	Pseudomonas aeruginosa PAO1

▶

Resolution resolution	7.90 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	40493

Type IV pilus from Pseudomonas PAO1 strain with PP7 Maturation protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Maturation protein A

State in the Current Structure

Other States of the Same Protein in the Database

Type IV major pilin protein PilA

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8tuw__assembly_1__model_1

8tuw__assembly_1__model_1 | I(q)

8tuw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Type IV pilus from Pseudomonas PAO1 strain with PP7 Maturation protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Maturation protein A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Type IV major pilin protein PilA

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8tuw__assembly_1__model_1

8tuw__assembly_1__model_1 | I(q)

8tuw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)