8wq2

Structural basis of translation inhibition by a valine tRNA-derived fragment

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

30S ribosomal protein S2

Sulfolobus acidocaldarius DSM 639

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS2_SULAC
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain AS2P； PDBConstruct 1–196； UniProt 28–223

30S ribosomal protein S4e

Sulfolobus acidocaldarius DSM 639

UniProt O05634

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS4E_SULAC
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain AS4E； PDBConstruct 1–240； UniProt 2–241

30S ribosomal protein S4

Sulfolobus acidocaldarius DSM 639

UniProt P39467

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS4_SULAC
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain AS4P； PDBConstruct 1–166； UniProt 3–168

30S ribosomal protein S5

Sulfolobus acidocaldarius DSM 639

UniProt O05641

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS5_SULAC
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain AS5P； PDBConstruct 1–204； UniProt 11–214

30S ribosomal protein S6e

Sulfolobus acidocaldarius DSM 639

UniProt Q4JAI1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS6E_SULAC
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain AS6E； PDBConstruct 1–105； UniProt 109–213

30S ribosomal protein S8e

Sulfolobus acidocaldarius DSM 639

UniProt Q4JAP5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS8E_SULAC
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain AS8E； PDBConstruct 1–126； UniProt 2–127

30S ribosomal protein S11

Sulfolobus acidocaldarius DSM 639

UniProt P39469

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS11_SULAC
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain S11P； PDBConstruct 1–128； UniProt 5–132

30S ribosomal protein S12

Sulfolobus acidocaldarius DSM 639

UniProt P11524

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS12_SULAC
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain S12P； PDBConstruct 1–143； UniProt 3–145

30S ribosomal protein S15

Sulfolobus acidocaldarius DSM 639

UniProt Q4JAI3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS15_SULAC
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain S15P； PDBConstruct 1–149； UniProt 1–149

30S ribosomal protein S17

Sulfolobus acidocaldarius DSM 639

UniProt Q4JB49

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS17_SULAC
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain S17P； PDBConstruct 1–111； UniProt 3–113

30S ribosomal protein S24e

Sulfolobus acidocaldarius DSM 639

UniProt Q4JAF9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS24_SULAC
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain S24E； PDBConstruct 1–96； UniProt 9–104

30S ribosomal protein S27e

Sulfolobus acidocaldarius DSM 639

UniProt Q4J9B1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS27_SULAC
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain S27E； PDBConstruct 1–59； UniProt 1–59

30S ribosomal protein S3Ae

Sulfolobus acidocaldarius DSM 639

UniProt Q4JB17

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS3A_SULAC
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain S3AE； PDBConstruct 1–189； UniProt 9–197

30S ribosomal protein S3

Sulfolobus acidocaldarius DSM 639

UniProt Q4JB46

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS3_SULAC
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain AS3P； PDBConstruct 1–201； UniProt 2–202

30S ribosomal protein S7

Sulfolobus acidocaldarius DSM 639

UniProt P17198

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS7_SULAC
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain AS7P； PDBConstruct 1–193； UniProt 3–195

30S ribosomal protein S9

Sulfolobus acidocaldarius DSM 639

UniProt P39468

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS9_SULAC
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain AS9P； PDBConstruct 1–136； UniProt 3–138

30S ribosomal protein S10

Sulfolobus acidocaldarius DSM 639

UniProt P17199

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS10_SULAC
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain S10P； PDBConstruct 1–100； UniProt 3–102

30S ribosomal protein S13

Sulfolobus acidocaldarius DSM 639

UniProt P39470

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS13_SULAC
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain S13P； PDBConstruct 1–147； UniProt 3–149

30S ribosomal protein S14 type Z

Sulfolobus acidocaldarius DSM 639

UniProt O05635

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS14Z_SULAC
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain S14P； PDBConstruct 1–52； UniProt 3–54

30S ribosomal protein S17e

Sulfolobus acidocaldarius DSM 639

UniProt Q4JAX5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS17E_SULAC
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain S17E； PDBConstruct 1–62； UniProt 2–63

30S ribosomal protein S19e

Sulfolobus acidocaldarius DSM 639

UniProt Q4J8U1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4J8U1_SULAC
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain S19E； PDBConstruct 1–150； UniProt 3–152

30S ribosomal protein S19

Sulfolobus acidocaldarius DSM 639

UniProt Q4JB44

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS19_SULAC
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain S19P； PDBConstruct 1–115； UniProt 9–123

30S ribosomal protein S27ae

Sulfolobus acidocaldarius DSM 639

UniProt Q4JAG0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS27A_SULAC
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain S27A； PDBConstruct 1–54； UniProt 12–65

30S ribosomal protein S28e

Sulfolobus acidocaldarius DSM 639

UniProt Q4JAV1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 50S ribosomal protein L7Ae × 1 （Q4J8P1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS28_SULAC
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain S28E； PDBConstruct 1–63； UniProt 19–81

50S ribosomal protein L7Ae

Sulfolobus acidocaldarius DSM 639

UniProt Q4J8P1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） Small ribosomal subunit protein uS8 × 1 （O05636） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL7A_SULAC
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain SL7A； PDBConstruct 1–123； UniProt 4–126

Small ribosomal subunit protein uS8

Sulfolobus acidocaldarius DSM 639

UniProt O05636

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 26 RNA 2	RNA (1328-MER) × 1 RNA (26-MER) × 1 30S ribosomal protein S2 × 1 （P39478） 30S ribosomal protein S4e × 1 （O05634） 30S ribosomal protein S4 × 1 （P39467） 30S ribosomal protein S5 × 1 （O05641） 30S ribosomal protein S6e × 1 （Q4JAI1） 30S ribosomal protein S8e × 1 （Q4JAP5） 30S ribosomal protein S11 × 1 （P39469） 30S ribosomal protein S12 × 1 （P11524） 30S ribosomal protein S15 × 1 （Q4JAI3） 30S ribosomal protein S17 × 1 （Q4JB49） 30S ribosomal protein S24e × 1 （Q4JAF9） 30S ribosomal protein S27e × 1 （Q4J9B1） 30S ribosomal protein S3Ae × 1 （Q4JB17） 30S ribosomal protein S3 × 1 （Q4JB46） 30S ribosomal protein S7 × 1 （P17198） 30S ribosomal protein S9 × 1 （P39468） 30S ribosomal protein S10 × 1 （P17199） 30S ribosomal protein S13 × 1 （P39470） 30S ribosomal protein S14 type Z × 1 （O05635） 30S ribosomal protein S17e × 1 （Q4JAX5） 30S ribosomal protein S19e × 1 （Q4J8U1） 30S ribosomal protein S19 × 1 （Q4JB44） 30S ribosomal protein S27ae × 1 （Q4JAG0） 30S ribosomal protein S28e × 1 （Q4JAV1） 50S ribosomal protein L7Ae × 1 （Q4J8P1） UNKNOWN LIGAND × 57	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RS8_SULAC
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain AS8P； PDBConstruct 1–130； UniProt 4–133

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8wq2
Deposition date deposition_date	2023-10-10
Structure title title	Structural basis of translation inhibition by a valine tRNA-derived fragment
Keywords keywords	Sulfolobus acidocaldarius ribosome, RIBOSOME; RIBOSOME
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8wq2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8wq2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8wq2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	72.17 Å
Rg (electron density)	73.72 Å
Total Rg	73.66 Å
Atom count	56872
Residues	4792
Excluded volume	909350 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8wq2__assembly_1__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (29)

Entity 1 Entity 1 polymer

Description description	RNA (1328-MER)
Molecular weight formula_weight	486920.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A16S
Atom count atom_count	56872

CGCCCCGAUUCCGGUUGAUCCUGCCGGACCCGACCGCUAUCGGGGUAGGGAUAAGCCAUGGGAGUCUUACACUCCCGGGUAAGGGAGUGUGGCGGACGGCUGAGUAACACGUGGCUAACCUACCCUCGGGACGGGGAUAACCCCGGGAAACUGGGGAUAAUCCCCGAUAGGGAAGGAGUCCUGGAAUGGUUCCUUCCCUAAAGGGCUAUAGGCUAUUUCCCGUUUGUAGCCGCCCGAGGAUGGGGCUACGGCCCAUCAGGCUGUCGGUGGGGUAAAGGCCCACCGAACCUAUAACGGGUAGGGGCCGUGGAAGCGGGAGCCUCCAGUUGGGCACUGAGACAAGGGCCCAGGCCCUACGGGGCGCACCAGGCGCGAAACGUCCCCAAUGCGCGAAAGCGUGAGGGCGCUACCCCGAGUGCCUCCGCAAGGAGGCUUUUCCCCGCUCUAAAAAGGCGGGGGAAUAAGCGGGGGGCAAGUCUGGUGUCAGCCGCCGCGGUAAUACCAGCUCCGCGAGUGGUCGGGGUGAUUACUGGGCCUAAAGCGCCUGUAGCCGGCCCACCAAGUCGCCCCUUAAAGUCCCCGGCUCAACCGGGGAACUGGGGGCGAUACUGGUGGGCUAGGGGGCGGGAGAGGCGGGGGGUACUCCCGGAGUAGGGGCGAAAUCCUUAGAUACCGGGAGGACCACCAGUGGCGGAAGCGCCCCGCUAGAACGCGCCCGACGGUGAGAGGCGAAAGCCGGGGCAGCAAACGGGAUUAGAUACCCCGGUAGUCCCGGCUGUAAACGAUGCGGGCUAGGUGUCGAGUAGGCUUAGAGCCUACUCGGUGCCGCAGGGAAGCCGUUAAGCCCGCCGCCUGGGGAGUACGGUCGCAAGACUGAAACUUAAAGGAAUUGGCGGGGGAGCACCACAAGGGGUGGAACCUGCGGCUCAAUUGGAGUCAACGCCUGGAAUCUUACCGGGGGAGACCGCAGUAUGACGGCCAGGCUAACGACCUUGCCUGACUCGCGGAGAGGAGGUGCAUGGCCGUCGCCAGCUCGUGUUGUGAAAUGUCCGGUUAAGUCCGGCAACGAGCGAGACCCCCACCCCUAGUUGGUAUUCUGGACUCCGGUCCAGAACCACACUAGGGGGACUGCCGGCGUAAGCCGGAGGAAGGAGGGGGCCACGGCAGGUCAGCAUGCCCCGAAACCCGGGCCGCACGCGGGUUACAAUGGCAGGGACAACGGGAUGCUACCUCGAAAGGGGGAGCCAAUCCUUAAACCCUGCCGCAGUUGGGAUCGAGGGCUGAAACCCGCCCUCGUGAACGAGGAAUCCCUAGUAACCGCGGGUCAACAACCCGCGGUGAAUACGUCCCUGCUCCUUGCACACACCGCCCGUCGCUCCACCCGAGCGAGAAAGGGGUGAGGUCCCUUGCGAUAAGUGGGGGAUCGAACUCCUUUCCCGCGAGGGGGGAGAAGUCGUAACAAGGUAGCCGUAGGGGAACCUGCGGCUGGAUCACCUCAUAU

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 2 Entity 2 polymer

Description description	RNA (26-MER)
Molecular weight formula_weight	8411.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	VTRF

GGGUUGGUGGUCUAGUCUGGUUAUGA

Source Source

Source organism organism	Haloferax volcanii
NCBI taxonomy ID ncbi_taxonomy_id	2246
Host organism host_organism	Haloferax volcanii

Entity 3 Entity 3 polymer

Description description	30S ribosomal protein S2
Molecular weight formula_weight	22474.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS2P

ELLVPLDTYLSAGVHIGTHTCTRYMERFIYRVRPEGLYVLDVRKIDERLRVAAKFISRFRPEAVLTVASRPYAFTPVQKFSEVVRGKEISGRFPPGTLTNPYLDNYIEPEVLIVTDPRTDLQAIKEASKVGIPIVAFTDTDARVDFIDVIIPANNKGRKSLALLYWVLARQILRERKEIPLDGDIPLRVEDFETRL

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 4 Entity 4 polymer

Description description	30S ribosomal protein S4e
Molecular weight formula_weight	27340.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS4E

VHITRFEAPWFLKVGKKEYKWIIRSRAGPHKIQESVPLAILLKYYLKAVDTTREAKRIIFDGKVLVDGKVRRDYKYPVGLMDVVEIPSADLRVRIIPDNVRYLTTINISREDAKYKFVRIMNKTTLKSGVLQLNLEDGRNILLKGEELSQYNLPTLTTLKIELPEQKITTAYTIKEGVYAMIIGGRNAGLHGKISKIQLAKYKRIKYSLVTLEGKDGSTFQTNLINVMAIGENEADSNLG

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 5 Entity 5 polymer

Description description	30S ribosomal protein S4
Molecular weight formula_weight	19440.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS4P

DPRKSKKKWMGPSHPWIKINLGKEQILIGKYGLRNKKEIWIAQTMIRNFRHQARSLLALPPAERNIREKQLIQKLYRMGILEKDNSTLDDILSLTEENYLERRLQTIVYKKGLARTIYQARQLITHGHIAISGRKVTSPGYVVLRGEEDLIDYYPTSPFKQNPPSQ

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 6 Entity 6 polymer

Description description	30S ribosomal protein S5
Molecular weight formula_weight	22782.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS5P

EDWKPRTKVGQLIKEGKINSMKELFERNLPIVEPEIVDVLLPKLRYDIVDIGIVQKQTDAGELSRYKVLIVMGNMDGYISYGTGKAKQLRVAIQKAIRDAKMRIIPVRRGCGSWECTCGESHSLPFIVSGKAGSVEVTLLPAPKGTGLVVGSVLKTFLSLAGLKDVWSRTKGSTYTHENFIKAAYIALYNTYRFVTPVDWGRMK

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 7 Entity 7 polymer

Description description	30S ribosomal protein S6e
Molecular weight formula_weight	11479.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS6E

ALAYRTRAFQLSLDQSKLPNLVGTKIGDVIDINVSGVNLKLKITGGSDNSGFSMRFDVGGGAKRKILVSGPPGYYPKEDGLRRKRTVRGNMITPEIVQINTIMIR

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 8 Entity 8 polymer

Description description	30S ribosomal protein S8e
Molecular weight formula_weight	14113.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS8E

SYYQGNDSRKITGGQKGKNRDKRKYELGSPPTETKISDKDIKEKDRVAGGNFKLRLRYASYANVYDPQSKTAKKVKIISVLESPANREYARRGIIVKGTLIQTELGKAKVTSRPGQDGIINALLLR

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 9 Entity 9 polymer

Description description	30S ribosomal protein S11
Molecular weight formula_weight	13652.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S11P

REIRWGNARIYASQNNTIITITDITGAEIISKASGGMVVKADREKPSPYAAMLAANKAANDAFDKGISAIHIKVRAQGGYGSKTPGPGAQPAIRALARAGFIIGRIEDVTPLPHDTIRRPGGRRGRRV

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 10 Entity 10 polymer

Description description	30S ribosomal protein S12
Molecular weight formula_weight	15703.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S12P

GSKSPKGLFAARKLRLKRLKFSWSQRSFKRRMLALKEKFDPLEGAPMARGIVLEKVGIESRQPNSAVRKAVRVQLVKNGRIVTAFVPGDGGVNFIDEHDEVVIAGIGGTLGRSMGDLPGVRYKVVMVNGVSLDALYKGKKQKP

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 11 Entity 11 polymer

Description description	30S ribosomal protein S15
Molecular weight formula_weight	17438.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S15P

MNKKRAKGNSHSIRPVRSGPPKWVRFTREEVELLVEELAKRGYPPSMIGMVLRDQYGVPLVKQITGRKLTAILQDRNMKPKIPEDLFNLMRRAVNIRRHLFEYPKDKSAKRGLEEVESKIRRLASYYKETGKLPQEWSYDPAKAELLVT

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 12 Entity 12 polymer

Description description	30S ribosomal protein S17
Molecular weight formula_weight	12602.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S17P

KKGQLVKNVGIEGVSAPSKTCDDEYCPYHGSLKVRGIVLEGKLIRARANRTGTVEREYIFYDSKYKRYERRRSRIHVHIPSCLEVKEGDNVIIGESRPIAKSISFVILGVK

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 13 Entity 13 polymer

Description description	30S ribosomal protein S24e
Molecular weight formula_weight	10765.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S24E

VSDKVEGIVERDIQNNVANRRELYIKLFHIGSGTPSRKELVKAIASTFSTAEDLVVVKKVFTNYGSGISYARVNVYKDKDSLQKLEPQYLIGRDTG

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 14 Entity 14 polymer

Description description	30S ribosomal protein S27e
Molecular weight formula_weight	6577.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S27E

MKAKFKILIPEPKSKFIRVKCRQCNNEQVIFSNATFPVRCLSCGAQIVIPKGGKAKIEG

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 15 Entity 15 polymer

Description description	30S ribosomal protein S3Ae
Molecular weight formula_weight	21876.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S3AE

IRDKWKLKKWYVITAPKVFGEALLGSTPAYDINKALSRKIEVTLYDLTGDYNLVYIHLYFKILGNISGDKLSTIFYGHELSRDYIRSLVRRKSSKINAVVDVTTKDGYMLRVKGLVLTTYRAHISQKTAIRKVISDITRKKAEESDFDQFVQDVIFGKLSNDIFQEAKKIYPLRKVEIEKTKLLKAPKV

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 16 Entity 16 polymer

Description description	30S ribosomal protein S3
Molecular weight formula_weight	22396.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS3P

VLIKRHFLQKAAIKVMVDEYLAKQFYNAEYAGVEIVKTPIGTRVIIYAGRPPLIIGKGGKTIKQLAQVLEKFFGLENPQITVTAAENPELNARVMAFRLAIALEKGYHFRRAAFITIRRIMSSGAVGAEVIVSGKLTSERAKYEKLKEGTVYKSGQQLEKIIDRAIGIAMLKPGVYGVEVVITKPTRSIDKIELKEKVEKT

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 17 Entity 17 polymer

Description description	30S ribosomal protein S7
Molecular weight formula_weight	21862.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS7P

ENIEVSNLNVKVFGKWDTKVEVRDPSLKKYIDLMSIYLPHTGGRHEHRRFGKSRIPIVERLINNLMRPGRNKGKKMLAYNIVKTTFDIIAVKTGQNPIQVLVRAIENAAPREEVTRIMYGGIVYYVAVDVAPQRRVDLALRHLVTGASEASFNNPKPIEEALAEEIIAAANNDNKSVAIRKKEEIERIALSSR

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 18 Entity 18 polymer

Description description	30S ribosomal protein S9
Molecular weight formula_weight	15638.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS9P

QAEQNFMITYARRKSARASCYIKPGNGKVFVNDIPIEIIPIEVVRYKIMEPLVLAGDKITSSIEARIYTQGGGIMGQADAARMALARALVKFTNSKELVEIYKSYDRTMLAGDPRQTESEKWMRYSARRWRQKAYR

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 19 Entity 19 polymer

Description description	30S ribosomal protein S10
Molecular weight formula_weight	11775.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S10P

TKARIRLWSSNIDSLNFVVNQIRNMAQKTGIQVSGPIPLPTTRMEVPVMRLPHGEGKKKWEHWEMKVHKRIIDIAADERVMRQLMRVRVPDDVYIEIELI

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 20 Entity 20 polymer

Description description	30S ribosomal protein S13
Molecular weight formula_weight	17140.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S13P

QQQFKYIVRLFGQDVDGTMKLPYALAMIKGIGYNTAMIIIRKLNLDKDKRLGEISDEDIKKIENLLNNKIIPESPNWIYNRQKDYESGADMHLVTSDLIFYVRNDIERERRSRSWRGVRHSLGLKVRGQRTRTTGRTGATIGVRRAK

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 21 Entity 21 polymer

Description description	30S ribosomal protein S14 type Z
Molecular weight formula_weight	6190.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S14P

KYKPPAERRFGKGVQLCKRCGSRDSVIQKYGLYLCRQCFREVAYPMGFRKTR

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 22 Entity 22 polymer

Description description	30S ribosomal protein S17e
Molecular weight formula_weight	7336.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S17E

GNVYTKDIKRVARELYDKFKDQASDKYDDNKKLVDEYVNVSSKKVKNRIAGYLTRYVKISKN

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 23 Entity 23 polymer

Description description	30S ribosomal protein S19e
Molecular weight formula_weight	17559.7 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S19E

TVQMVPADILIPKLAEYLKNNVKELNPPNWVYFAKTASFKERVPDDIENWWYIRAASLLRHLYIYKEPIGLQKTRKLYSGSKRRGTKPPRSVKAPTHSIRTILQQLEKAGLVTKTRRGRILSPKGRSLLDKLAYEMFKELAEKKQDLKKY

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 24 Entity 24 polymer

Description description	30S ribosomal protein S19
Molecular weight formula_weight	13800.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S19P

WKKFRYRGKSLEDLLNMPMDEFIKLLPSRQRRSLKRGFSDKQRRLLEKIRKISREGKQNKVIKTHVRNMVILPEMVGLRFAVYNGKEFVEFQVVPEMIGRYLGEYSITTKKVEHG

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 25 Entity 25 polymer

Description description	30S ribosomal protein S27ae
Molecular weight formula_weight	6261.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S27A

QSKAVVRTYYEVEQDSIKLKNKKCPRCGSIMAHHMKPLERWACGKCGYTEFIGK

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 26 Entity 26 polymer

Description description	30S ribosomal protein S28e
Molecular weight formula_weight	7094.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S28E

GFPAEVIQILDRTGVTGEVTQVRVRVLEGRDKGRILTRNVKGPVRLGDILILRETEREARKLS

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 27 Entity 27 polymer

Description description	50S ribosomal protein L7Ae
Molecular weight formula_weight	13351.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	SL7A

PSYVKFEVPQELADKVLEAVKKAKDSGKIKKGTNETTKAVERSQAKLVVIAEDVQPEEIVAHLPLLCEEKKIPYVYVPSKKSLGEACGLQVAAASVALMDPGEAKDLVDEIVKRVNEIKGKSS

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 28 Entity 28 polymer

Description description	Small ribosomal subunit protein uS8
Molecular weight formula_weight	14624.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	AS8P

INPLANALATLYNNEMRRNKQALITPASKLIISVLRVMQKEGYIGEFEYIDDGRAGKIIVQLLGRINKCGPISPRYPLDYNGLLRLPDYIRKYLPSKEIGIIIISTPKGVMSHRDGIREKIGGVTLGYVY

Source Source

Source organism organism	Sulfolobus acidocaldarius DSM 639
NCBI taxonomy ID ncbi_taxonomy_id	330779
Host organism host_organism	Sulfolobus acidocaldarius DSM 639

Entity 29 Entity 29 non-polymer

Description description	UNKNOWN LIGAND
Molecular weight formula_weight	103.1 kDa
Source method src_method	syn
Copy count entity_count	57

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	4.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	9742

Structural basis of translation inhibition by a valine tRNA-derived fragment

1. Protein Identity and Related Structures Protein Identity & Related Structures

30S ribosomal protein S2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S4e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S6e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S8e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S11

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S15

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

30S ribosomal protein S17

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer