8xny

Respiratory complex Peripheral Arm of CI, open form B, focus-refined map of type II, Wild type mouse under Cold Acclimation

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH-ubiquinone oxidoreductase chain 3

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU3M_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–115； UniProt 1–115

NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial

OrganismNot specified

UniProt Q9DC70

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS7_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–224； UniProt 1–224

NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial

OrganismNot specified

UniProt Q9DCT2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS3_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–263； UniProt 1–263

NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial

OrganismNot specified

UniProt Q91WD5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS2_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–463； UniProt 1–463

NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

OrganismNot specified

UniProt Q9D6J6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUV2_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–248； UniProt 1–248

NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

OrganismNot specified

UniProt Q91YT0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUV1_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–464； UniProt 1–464

NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

OrganismNot specified

UniProt Q91VD9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS1_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–727； UniProt 1–727

NADH-ubiquinone oxidoreductase chain 1

OrganismNot specified

UniProt P03888

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NU1M_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–318； UniProt 1–318

NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial

OrganismNot specified

UniProt Q8K3J1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS8_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–212； UniProt 1–212

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial

OrganismNot specified

UniProt Q9DC69

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA9_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain P； PDBConstruct 1–377； UniProt 1–377

NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial

OrganismNot specified

UniProt Q9CXZ1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS4_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain Q； PDBConstruct 1–175； UniProt 1–175

NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial

OrganismNot specified

UniProt P52503

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUS6_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain R； PDBConstruct 1–116； UniProt 1–116

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2

OrganismNot specified

UniProt Q9CQ75

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA2_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain S； PDBConstruct 1–99； UniProt 1–99

Acyl carrier protein, mitochondrial

OrganismNot specified

UniProt Q9CR21

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ACPM_MOUSE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain T； PDBConstruct 1–156； UniProt 1–156

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5

OrganismNot specified

UniProt Q9CPP6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA5_MOUSE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain V； PDBConstruct 1–116； UniProt 1–116

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6

OrganismNot specified

UniProt Q9CQZ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA6_MOUSE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain W； PDBConstruct 1–131； UniProt 1–131

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8

OrganismNot specified

UniProt Q9DCJ5

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA8_MOUSE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain X； PDBConstruct 1–172； UniProt 1–172

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13

OrganismNot specified

UniProt Q9ERS2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUAD_MOUSE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain Z； PDBConstruct 1–144； UniProt 1–144

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1

OrganismNot specified

UniProt O35683

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA1_MOUSE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain a； PDBConstruct 1–70； UniProt 1–70

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3

OrganismNot specified

UniProt Q9CQ91

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA3_MOUSE
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain b； PDBConstruct 1–84； UniProt 1–84

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12

OrganismNot specified

UniProt Q7TMF3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUAC_MOUSE
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain q； PDBConstruct 1–145； UniProt 1–145

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7

OrganismNot specified

UniProt Q9Z1P6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial × 1 （Q8BK30） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUA7_MOUSE
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain r； PDBConstruct 1–113； UniProt 1–113

NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial

OrganismNot specified

UniProt Q8BK30

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 23	NADH-ubiquinone oxidoreductase chain 3 × 1 （P03899） NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial × 1 （Q9DC70） NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial × 1 （Q9DCT2） NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial × 1 （Q91WD5） NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial × 1 （Q9D6J6） NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial × 1 （Q91YT0） NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial × 1 （Q91VD9） NADH-ubiquinone oxidoreductase chain 1 × 1 （P03888） NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial × 1 （Q8K3J1） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial × 1 （Q9DC69） NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial × 1 （Q9CXZ1） NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial × 1 （P52503） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2 × 1 （Q9CQ75） Acyl carrier protein, mitochondrial × 1 （Q9CR21） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 × 1 （Q9CPP6） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 × 1 （Q9CQZ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8 × 1 （Q9DCJ5） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 × 1 （Q9ERS2） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1 × 1 （O35683） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 × 1 （Q9CQ91） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12 × 1 （Q7TMF3） NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7 × 1 （Q9Z1P6） 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 IRON/SULFUR CLUSTER × 6 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE × 2 FE2/S2 (INORGANIC) CLUSTER × 2 FLAVIN MONONUCLEOTIDE × 1 NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE × 1 ZINC ION × 1 ;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ; × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	NDUV3_MOUSE
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain s； PDBConstruct 1–104； UniProt 1–104

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8xny
Deposition date deposition_date	2023-12-30
Structure title title	Respiratory complex Peripheral Arm of CI, open form B, focus-refined map of type II, Wild type mouse under Cold Acclimation
Keywords keywords	Respiratory complex, Respiratory supercomplex, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8xny__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8xny__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8xny__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	57.08 Å
Rg (electron density)	57.79 Å
Total Rg	57.60 Å
Atom count	33176
Residues	4116
Excluded volume	595930 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8xny__assembly_1__model_1`	23-meric （23）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (31)

Entity 1 Entity 1 polymer

Description description	NADH-ubiquinone oxidoreductase chain 3
Molecular weight formula_weight	13223.8 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	33176

MNLYTVIFINILLSLTLILVAFWLPQMNLYSEKANPYECGFDPTSSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQTIKTSTMMIMAFILVTILSLGLAYEWTQKGLEWTE

Entity 2 Entity 2 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
Molecular weight formula_weight	24715.9 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MAALAAPGLLSVRILGLRTAQVQLRRVHQSVATEGPSPSPSPSLSSTQSAVSKAGAGAVVPKLSHLPRSRAEYVVTKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQADVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQLQRKIKREQKLKIWYRR

Entity 3 Entity 3 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
Molecular weight formula_weight	30191.3 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MAAAAARVWCRGLLGAASVGRGAGRPSVLWQHVRRESAAADKRPTVRPRSDVTHKQLSAFGEYVAEILPKYVQQVQVSCLDELEICIHPDGVIPTLTFLRDHTNAQFKSLADLTAVDVPTRQNRFEIVYNLLSLRFNSRIRVKTYADELTPIDSIVSVHIAANWYEREVWDMFGVFFFNHPDLRRILTDYGFEGHPFRKDFPLTGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPWEAFPAYRQPPESLKLEAGDKKPETK

Entity 4 Entity 4 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
Molecular weight formula_weight	52693.6 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAALRALRCLRGVGAPVLRPGSGIRLPSQPSRGARQWQPDIEWAEQFSGAVMYPSKETAHWKPPPWNDVDILKEKAVTNMTLNFGPQHPAAHGVLRLVLELSGEMVRKCDPHIGLLHRGTEKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSIAVEKLLNIQPPPRAQWIRVLFGEITRILNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYIRPGGVHQDLPLGLLDDIYEFSKNFSLRIDEVEEMLTNNRIWRNRTVDIGVVTAEDALNYGFSGVMLRGSGIQWDLRKTQPYDVYDQVEFDVPIGSRGDCYDRYLCRVEEMRQSLRIIEQCLNKMPPGEIKVDDAKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPYRCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEIDR

Entity 5 Entity 5 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
Molecular weight formula_weight	27318.3 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MFSLALRARATGLAAQWGRHARNLHKTAVHNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHQAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRDSDSILETLQRKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTPKDIEEIIDELKAGKVPKPGPRSGRFCCEPAGGLTSLTEPPKGPGFGVQAGL

Entity 6 Entity 6 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
Molecular weight formula_weight	50904.2 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MLAARHFLGGLVPVRVSVRFSSGTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGALRRGDWYKTKEILLKGPDWILGEMKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEGEPGTCKDREIMRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAGLIGKNACGSDYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPTTVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELIEKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRSTDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVKGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEDRMQRFAQQHRAWQAAS

Entity 7 Entity 7 polymer

Description description	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
Molecular weight formula_weight	79866.7 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MLRIPIKRALIGLSNSPKGYVRTTGTAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNVIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQNFEGNAVAAIAGGLVDAEALVALKDLLNKVDSDNLCTEEIFPTEGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASGRHSFCEVLKDAKKPMVVLGSSALQRDDGAAILVAVSNMVQKIRVTTGVAAEWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCITRQDLPKDCFIVYQGHHGDVGAPMADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLPYDTLDQVRNRLEEVSPNLVRYDDIEETNYFQQASELAKLVNQEVLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQAVEEPSIC

Entity 8 Entity 8 polymer

Description description	NADH-ubiquinone oxidoreductase chain 1
Molecular weight formula_weight	36077.0 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MFFINILTLLVPILIAMAFLTLVERKILGYMQLRKGPNIVGPYGILQPFADAMKLFMKEPMRPLTTSMSLFIIAPTLSLTLALSLWVPLPMPHPLINLNLGILFILATSSLSVYSILWSGWASNSKYSLFGALRAVAQTISYEVTMAIILLSVLLMNGSYSLQTLITTQEHMWLLLPAWPMAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYTNIILMNALTTIIFLGPLYYINLPELYSTNFMMEALLLSSTFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHISLPIFTAGVPPYM

Entity 9 Entity 9 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
Molecular weight formula_weight	24068.4 kDa
EC 编号 ec_number	7.1.1.2
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MYRLSSSMLPRALAQAMRTGHLNGQSLHSSAVAATYKYVNKKEQESEVDMKSATDNAARILMWTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEELLYNKEKLLNNGDKWEAEIAANIQADYLYR

Entity 10 Entity 10 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
Molecular weight formula_weight	42588.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MAAAVRFRVVRALPMSRPAITAAATSVFCGSSHRQLHHAVIPHGKGGRSSVSGVVATVFGATGFLGRYVVNHLGRMGSQVIIPYRCDVYDIMHLRLMGDLGQLTFLEWDARDKDSIRKAVQHSNVVINLIGREWETRNFDFEDVFVNIPRAIAQASKEAGVERFIHVSHLNASMKSSSKSLRSKAVGEKEVRSVFPEAIIIRPSDIFGREDRFLNHFANYRWFLAVPLVSLGFKTVKQPVYVADVSKGIVNATKDPDAVGKTFAFTGPNRYLLFHLVKYIFGMTHRTFIPYPLPLFVYSWIGKLFGLSPFEPWTTKDKVERIHISDVMPTDLPGLEDLGVQPTPLELKSIEVLRRHRTYRWLSSEIEETKPAKTVNY

Entity 11 Entity 11 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
Molecular weight formula_weight	19814.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MAAVSISVSLRQAMLGRRAMATAAVSVCRVPSRLLSTSTWKLADNQTRDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSAKEDAIAFAEKNGWSYDVEEKKVPKPKSKSYGANFSWNKRTRVSTK

Entity 12 Entity 12 polymer

Description description	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
Molecular weight formula_weight	13041.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MAAVLTFRRLLTLPRAARGFGVQVSPSGEKITHTGQVYDEKDYRRVRFVDRQKEVNENFAIDLIAQQPVNEVEHRIIACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFKQHHH

Entity 13 Entity 13 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
Molecular weight formula_weight	10932.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MAAAAASRAVGAKLGLREIRVHLCQRSPGSQGVRDFIVQRYVELKKAHPNLPILIRECSEVQPKLWARYAFGQEKTVSLNNLSADEVTRAMQNVLSGKA

Entity 14 Entity 14 polymer

Description description	Acyl carrier protein, mitochondrial
Molecular weight formula_weight	17390.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTTLCPEGIRRRPGALQSALALAQVPGTVTHLCRQYSDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE

Entity 15 Entity 15 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
Molecular weight formula_weight	13380.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MAGLLKKTTGLVGLAVCDTPHERLTILYTKTLDILKHFPKHAAYRKYTEQITNEKLDMVKAEPDVKKLEALLQGGEVEEVILQAEKELSLARKMLKWKPWEPLVEEPPANQWKWPI

Entity 16 Entity 16 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
Molecular weight formula_weight	15311.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MAAAATGLRQAAAAAASTSVKPIFSRDLNEAKRRVRELYRAWYREVPNTVHLMQLDITVKQGRDKVREMFMKNAHVTDPRVVDLLVIKGKMELQETIKVWKQRTHVMRFFHETETPRPKDFLSKFYMGHDP

Entity 17 Entity 17 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
Molecular weight formula_weight	20025.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MPGIVELPTLEELKVEEVKVSSAVLKAAAHHYGAQCDKTNKEFMLCRWEEKDPRRCLKEGKLVNGCALNFFRQIKSHCAEPFTEYWTCLDYSNMQLFRHCRQQQAKFDQCVLDKLGWVRPDLGQLSKVTKVKTDRPLPENPYHSRARPEPNPVIEGDLKPAKHGTRFFFWTV

Entity 18 Entity 18 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
Molecular weight formula_weight	16881.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMFAVGIGALIFGYWRMMRWNQERRRLLIEDLEARIALMPLFQAEKDRRTLQILRENLEEEAIIMKDVPNWKVGESVFHTTRWVPPLIGEMYGLRTKEEMSNANFGFTWYT

Entity 19 Entity 19 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
Molecular weight formula_weight	8149.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MWFEILPGLAIMGVCLVIPGVSTAYIHKFTNGGKEKRVARVQYQWYLMERDRRISGVNRYYVSKGLENID

Entity 20 Entity 20 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3
Molecular weight formula_weight	9338.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MAGRISAFLKNAWAKEPVLVVSFSVWGLAIIMPMISPYTKYASMINKATPYNYPVPVRDDGNMPDVPSHPQDPLGPSLDWLKNL

Entity 21 Entity 21 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
Molecular weight formula_weight	17112.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q

MELVEVLKRGVQQVTGHGGLRGLLRVFFRANDIRIGTLVGEDKYGNKYYEDNKQFFGRHRWVIYTTEMNGKNTFWDVDGSMVPPEWHRWLHCMTDDPPTTNPPTARKFIWTNHKFNVSATPEQYVPYSTTRKKIHEWVPPSTPYK

Entity 22 Entity 22 polymer

Description description	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
Molecular weight formula_weight	12595.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	r

MASATRVIQKLRNWASGQDLQAKLQLRYQEIAKRTQPPPKLPVGPSHKLSNNYYCTRDGRREVVPPSIIMSSQKALVSGKAAESSAMAATEKKAVTPAPPMKRWELSKDQPYL

Entity 23 Entity 23 polymer

Description description	NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
Molecular weight formula_weight	11833.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	s

MAVSLLLRGGRIRALKAVLLEARVFPGELVSVVRLSTESEKSAKEKELHPKTQSVLKEPEPTDTTTYKNLQHHDYNTYTFLDLNLDLSKFRLPQPSSGRESPRH

Entity 24 Entity 24 non-polymer

Description description	1,2-Distearoyl-sn-glycerophosphoethanolamine
Molecular weight formula_weight	748.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 25 Entity 25 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 26 Entity 26 non-polymer

Description description	1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE
Molecular weight formula_weight	790.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 27 Entity 27 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 28 Entity 28 non-polymer

Description description	FLAVIN MONONUCLEOTIDE
Molecular weight formula_weight	456.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 29 Entity 29 non-polymer

Description description	NADPH DIHYDRO-NICOTINAMIDE-ADENINE-DINUCLEOTIDE PHOSPHATE
Molecular weight formula_weight	745.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 30 Entity 30 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 31 Entity 31 non-polymer

Description description	;~{S}-[2-[3-[[(2~{R})-3,3-dimethyl-2-oxidanyl-4-phosphonooxy-butanoyl]amino]propanoylamino]ethyl] (3~{S})-3-oxidanyltetradecanethioate ;
Molecular weight formula_weight	584.7 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Resolution resolution	4.10 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	11712

Respiratory complex Peripheral Arm of CI, open form B, focus-refined map of type II, Wild type mouse under Cold Acclimation

1. Protein Identity and Related Structures Protein Identity & Related Structures

NADH-ubiquinone oxidoreductase chain 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH-ubiquinone oxidoreductase chain 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer