SAXSdb — 8xz6

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Radixin

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	;Spike protein S2' ; × 1 （K9N5Q8） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	;Spike protein S2' ; × 1 （K9N5Q8） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	;Spike protein S2' ; × 1 （K9N5Q8） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	;Spike protein S2' ; × 1 （K9N5Q8） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RADI_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–298； UniProt 1–296 Author chain B； PDBConstruct 3–298； UniProt 1–296 Author chain C； PDBConstruct 3–298； UniProt 1–296 Author chain D； PDBConstruct 3–298； UniProt 1–296

;Spike protein S2' ;

OrganismNot specified

UniProt K9N5Q8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Radixin × 1 （P35241） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Radixin × 1 （P35241） water × 2	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 2	Radixin × 1 （P35241） water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 2	Radixin × 1 （P35241） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SPIKE_MERS1
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain E； PDBConstruct 1–13； UniProt 1334–1346 Author chain F； PDBConstruct 1–13； UniProt 1334–1346 Author chain G； PDBConstruct 1–13； UniProt 1334–1346 Author chain H； PDBConstruct 1–13； UniProt 1334–1346

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8xz6
Deposition date deposition_date	2024-01-20
Structure title title	MERS-CoV S and radixin complex structure
Keywords keywords	MERS-CoV, S, ezrin-radixin-moesin, cytoskeleton, assembly, VIRAL PROTEIN/PROTEIN BINDING, VIRAL PROTEIN-PROTEIN BINDING complex; VIRAL PROTEIN/PROTEIN BINDING
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8xz6__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8xz6__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8xz6__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.00 Å
Rg (electron density)	21.92 Å
Total Rg	22.91 Å
Atom count	2538
Residues	307
Excluded volume	45472 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8xz6__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8xz6__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`8xz6__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`8xz6__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Radixin
Molecular weight formula_weight	35325.7 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	10612

GSMPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLKLNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPETAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRK

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	;Spike protein S2' ;
Molecular weight formula_weight	1709.8 kDa
Source method src_method	syn
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

NRCCDRYEEYDLE

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	505

▶

Unit-cell length a length_a	70.310 Å
Unit-cell length b length_b	94.100 Å
Unit-cell length c length_c	134.300 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	93.28 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	2.120 Å
Low-resolution limit resolution_low	32.885 Å
R factor r_factor	0.2220
R_work r_work	0.2201
R_free r_free	0.2564

MERS-CoV S and radixin complex structure

1. Protein Identity and Related Structures Protein Identity & Related Structures

Radixin

State in the Current Structure

Other States of the Same Protein in the Database

;Spike protein S2' ;

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8xz6__assembly_3__model_1

8xz6__assembly_3__model_1 | I(q)

8xz6__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)

MERS-CoV S and radixin complex structure

1. Protein Identity and Related Structures Protein Identity & Related Structures

Radixin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

;Spike protein S2' ;

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8xz6__assembly_3__model_1

8xz6__assembly_3__model_1 | I(q)

8xz6__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)