SAXSdb — 8y0q

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

VP1 of capsid protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 360	VP2 of capsid protein × 60 （J9PGT1） VP3 of capsid protein × 60 （A0A1C6ZW66） VP4 of capsid protein × 60 （J9PGT1） pOA2 VH × 60 pOA2 VL × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	VP2 of capsid protein × 1 （J9PGT1） VP3 of capsid protein × 1 （A0A1C6ZW66） VP4 of capsid protein × 1 （J9PGT1） pOA2 VH × 1 pOA2 VL × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 30	VP2 of capsid protein × 5 （J9PGT1） VP3 of capsid protein × 5 （A0A1C6ZW66） VP4 of capsid protein × 5 （J9PGT1） pOA2 VH × 5 pOA2 VL × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 36	VP2 of capsid protein × 6 （J9PGT1） VP3 of capsid protein × 6 （A0A1C6ZW66） VP4 of capsid protein × 6 （J9PGT1） pOA2 VH × 6 pOA2 VL × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 6	VP2 of capsid protein × 1 （J9PGT1） VP3 of capsid protein × 1 （A0A1C6ZW66） VP4 of capsid protein × 1 （J9PGT1） pOA2 VH × 1 pOA2 VL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1P8DYS7_9PICO
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain 1； PDBConstruct 1–213； UniProt 1–213

VP2 of capsid protein

OrganismNot specified

UniProt J9PGT1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 360	VP1 of capsid protein × 60 （A0A1P8DYS7） VP3 of capsid protein × 60 （A0A1C6ZW66） pOA2 VH × 60 pOA2 VL × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	VP1 of capsid protein × 1 （A0A1P8DYS7） VP3 of capsid protein × 1 （A0A1C6ZW66） pOA2 VH × 1 pOA2 VL × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 30	VP1 of capsid protein × 5 （A0A1P8DYS7） VP3 of capsid protein × 5 （A0A1C6ZW66） pOA2 VH × 5 pOA2 VL × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 36	VP1 of capsid protein × 6 （A0A1P8DYS7） VP3 of capsid protein × 6 （A0A1C6ZW66） pOA2 VH × 6 pOA2 VL × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 6	VP1 of capsid protein × 1 （A0A1P8DYS7） VP3 of capsid protein × 1 （A0A1C6ZW66） pOA2 VH × 1 pOA2 VL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	J9PGT1_9PICO
Isoform	—
PDB entities	2, 4
Chains and sequence ranges	Author chain 2； PDBConstruct 1–218； UniProt 287–504 Author chain 4； PDBConstruct 1–85； UniProt 202–286

VP3 of capsid protein

OrganismNot specified

UniProt A0A1C6ZW66

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 360	VP1 of capsid protein × 60 （A0A1P8DYS7） VP2 of capsid protein × 60 （J9PGT1） VP4 of capsid protein × 60 （J9PGT1） pOA2 VH × 60 pOA2 VL × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 6	VP1 of capsid protein × 1 （A0A1P8DYS7） VP2 of capsid protein × 1 （J9PGT1） VP4 of capsid protein × 1 （J9PGT1） pOA2 VH × 1 pOA2 VL × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 30	VP1 of capsid protein × 5 （A0A1P8DYS7） VP2 of capsid protein × 5 （J9PGT1） VP4 of capsid protein × 5 （J9PGT1） pOA2 VH × 5 pOA2 VL × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 36	VP1 of capsid protein × 6 （A0A1P8DYS7） VP2 of capsid protein × 6 （J9PGT1） VP4 of capsid protein × 6 （J9PGT1） pOA2 VH × 6 pOA2 VL × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 6	VP1 of capsid protein × 1 （A0A1P8DYS7） VP2 of capsid protein × 1 （J9PGT1） VP4 of capsid protein × 1 （J9PGT1） pOA2 VH × 1 pOA2 VL × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1C6ZW66_9PICO
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 3； PDBConstruct 1–220； UniProt 304–523

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8y0q
Deposition date deposition_date	2024-01-23
Structure title title	Complex of FMDV O/18074 and inter-serotype broadly neutralizing antibodies pOA-2
Keywords keywords	Foot-and-mouth disease virus O, Sus scrofa, VIRUS/IMMUNE SYSTEM, VIRUS-IMMUNE SYSTEM complex; VIRUS/IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8y0q__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8y0q__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8y0q__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	140.40 Å
Total Rg	140.60 Å
Atom count	411480
Residues	53160
Excluded volume	7297700 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8y0q__assembly_1__model_1`	360-meric （360）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`8y0q__assembly_2__model_1`	hexameric （6）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`8y0q__assembly_3__model_1`	30-meric （30）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`8y0q__assembly_4__model_1`	36-meric （36）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`8y0q__assembly_5__model_1`	hexameric （6）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	VP1 of capsid protein
Molecular weight formula_weight	23686.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1
Atom count atom_count	6858

TTSAGESADPVTTTVENYGGETQAQRRQHTDVTFILDRFVKVKPQEEINVLDLMQIPAHTLVGALLRTATYYFSDLELAVKHEGDLTWVPNGAPEAALDNTTNPTAYHKEPLTRLALPYTAPHRVLATVYNGSNKYGDTSTNNVRGDLHVLAKNAERTLPTSFNYGAIKATRVTELLYRMKRAETYCPRPLLAIQPSTARHKQKIVAPVKQLL

Entity 2 Entity 2 polymer

Description description	VP2 of capsid protein
Molecular weight formula_weight	24350.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

DKKTEETTLLEDRILTTRNGHTTSTTQSSVGVTYGYATAEDFVSGPNTSGLETRVVQAERFFKTHLFDWGTNDSFGRCHLLELPTDHKGVYGSLTDSYAYMRNGWDVEVTAVGNQFNGGCLLVAMVPELCSITKRELYQLTLFPHQFINPRTNMTAHITVPYLGVNRYDQYKVHKPWTLVVTVVAPLTVKNEGAPQIKVYANIAPTNVYVAGELPSKE

Entity 3 Entity 3 polymer

Description description	VP3 of capsid protein
Molecular weight formula_weight	23886.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

GIFPVACSDGYGGLVTTDPKTADPVYGKVFNPPRNLLPGRFTNLLDVAEACPTFLRFDSDVPYVTTKTDSDRKLVQFDLSLAAKHMSNTFLAGLAQYYTQYSGTINLHFMFTGPTDAKARYMVAYAPPGMEPPTTPEAAAHCIHAEWDTGLNSKFTFSIPYLSAADYAYTASDVAETTNVQGWVCLFQITHGKADGDALVVLASAGKDFDLRLPVDARAQ

Entity 4 Entity 4 polymer

Description description	VP4 of capsid protein
Molecular weight formula_weight	8862.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

GAGQSSPTTGSQNQSGNTGSIINNYYMQQYQNSMDTQLGDNAISGGSNEGSTDTTSTHTNNTQNNDWFSKLANTAFSGLFGALLA

Entity 5 Entity 5 polymer

Description description	pOA2 VH
Molecular weight formula_weight	13721.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

EEKVVESGGGLVQPGGSLRLSCVGSGFNFKNYEINWVRQAPGKALEWLAYITQTSDFIYYADSVKGRFTISRDNSRNTAYLQMNNLRTEDTARYFCTRAGLTGCKSRHCMYVWGPGAEVVVSS

Source Source

Source organism organism	Sus scrofa
NCBI taxonomy ID ncbi_taxonomy_id	9823
Host organism host_organism	Homo sapiens

Entity 6 Entity 6 polymer

Description description	pOA2 VL
Molecular weight formula_weight	11587.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

QTVIQEPAMSVSLGGTVTLTCGFISGSVTGTNYPSWFQQTPGQPPRLLIYYANSRPTEVPSRFSGAISGNKAALTITGAQAEDEADYFCCLYKTNNNILFGGGTHLTVL

Source Source

Source organism organism	Sus scrofa
NCBI taxonomy ID ncbi_taxonomy_id	9823
Host organism host_organism	Homo sapiens

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.44 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	3202

Complex of FMDV O/18074 and inter-serotype broadly neutralizing antibodies pOA-2

1. Protein Identity and Related Structures Protein Identity & Related Structures

VP1 of capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

VP2 of capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

VP3 of capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8y0q__assembly_1__model_1

8y0q__assembly_1__model_1 | I(q)

8y0q__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

7. Citations (1)

Complex of FMDV O/18074 and inter-serotype broadly neutralizing antibodies pOA-2

1. Protein Identity and Related Structures Protein Identity & Related Structures

VP1 of capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

VP2 of capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

VP3 of capsid protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8y0q__assembly_1__model_1

8y0q__assembly_1__model_1 | I(q)

8y0q__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Source Source

Entity 6 Entity 6 polymer

Polymer Polymer

Source Source

7. Citations (1)