8ypk

mouse proteasome 20S subunit in complex with compound 1

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit beta type-6

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-3 × 2 （Q9R1P1） [(1R)-1-[(1-cyclohexyl-1,2,3-triazol-4-yl)carbonylamino]-3-methyl-butyl]boronic acid × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB6_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–205； UniProt 34–238 Author chain F； PDBConstruct 1–205； UniProt 34–238

Proteasome subunit alpha type-2

OrganismNot specified

UniProt P49722

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit beta type-6 × 2 （Q60692） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-3 × 2 （Q9R1P1） [(1R)-1-[(1-cyclohexyl-1,2,3-triazol-4-yl)carbonylamino]-3-methyl-butyl]boronic acid × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA2_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain P； PDBConstruct 1–234； UniProt 1–234 Author chain b； PDBConstruct 1–234； UniProt 1–234

Proteasome subunit alpha type-7

OrganismNot specified

UniProt Q9Z2U0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit beta type-6 × 2 （Q60692） Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-3 × 2 （Q9R1P1） [(1R)-1-[(1-cyclohexyl-1,2,3-triazol-4-yl)carbonylamino]-3-methyl-butyl]boronic acid × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA7_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain I； PDBConstruct 1–248； UniProt 1–248 Author chain N； PDBConstruct 1–248； UniProt 1–248

Proteasome subunit alpha type-6

OrganismNot specified

UniProt Q9QUM9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit beta type-6 × 2 （Q60692） Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-3 × 2 （Q9R1P1） [(1R)-1-[(1-cyclohexyl-1,2,3-triazol-4-yl)carbonylamino]-3-methyl-butyl]boronic acid × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA6_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain K； PDBConstruct 1–246； UniProt 1–246 Author chain R； PDBConstruct 1–246； UniProt 1–246

Proteasome subunit beta type-2

OrganismNot specified

UniProt Q9R1P3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit beta type-6 × 2 （Q60692） Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-3 × 2 （Q9R1P1） [(1R)-1-[(1-cyclohexyl-1,2,3-triazol-4-yl)carbonylamino]-3-methyl-butyl]boronic acid × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB2_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain T； PDBConstruct 1–201； UniProt 1–201 Author chain V； PDBConstruct 1–201； UniProt 1–201

Proteasome subunit beta type-1

OrganismNot specified

UniProt O09061

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit beta type-6 × 2 （Q60692） Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-3 × 2 （Q9R1P1） [(1R)-1-[(1-cyclohexyl-1,2,3-triazol-4-yl)carbonylamino]-3-methyl-butyl]boronic acid × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB1_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain S； PDBConstruct 1–240； UniProt 1–240 Author chain X； PDBConstruct 1–240； UniProt 1–240

Proteasome subunit beta type-5

OrganismNot specified

UniProt O55234

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit beta type-6 × 2 （Q60692） Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-3 × 2 （Q9R1P1） [(1R)-1-[(1-cyclohexyl-1,2,3-triazol-4-yl)carbonylamino]-3-methyl-butyl]boronic acid × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB5_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain C； PDBConstruct 1–205； UniProt 60–264 Author chain D； PDBConstruct 1–205； UniProt 60–264

Proteasome subunit alpha type-3

OrganismNot specified

UniProt O70435

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit beta type-6 × 2 （Q60692） Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-3 × 2 （Q9R1P1） [(1R)-1-[(1-cyclohexyl-1,2,3-triazol-4-yl)carbonylamino]-3-methyl-butyl]boronic acid × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA3_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain J； PDBConstruct 1–255； UniProt 1–255 Author chain Q； PDBConstruct 1–255； UniProt 1–255

Proteasome subunit alpha type-1

OrganismNot specified

UniProt Q9R1P4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit beta type-6 × 2 （Q60692） Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-3 × 2 （Q9R1P1） [(1R)-1-[(1-cyclohexyl-1,2,3-triazol-4-yl)carbonylamino]-3-methyl-butyl]boronic acid × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA1_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain G； PDBConstruct 1–263； UniProt 1–263 Author chain L； PDBConstruct 1–263； UniProt 1–263

Proteasome subunit alpha type-5

OrganismNot specified

UniProt Q9Z2U1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit beta type-6 × 2 （Q60692） Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-3 × 2 （Q9R1P1） [(1R)-1-[(1-cyclohexyl-1,2,3-triazol-4-yl)carbonylamino]-3-methyl-butyl]boronic acid × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA5_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain H； PDBConstruct 1–241； UniProt 1–241 Author chain M； PDBConstruct 1–241； UniProt 1–241

Proteasome subunit alpha type-4

OrganismNot specified

UniProt Q9R1P0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit beta type-6 × 2 （Q60692） Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-3 × 2 （Q9R1P1） [(1R)-1-[(1-cyclohexyl-1,2,3-triazol-4-yl)carbonylamino]-3-methyl-butyl]boronic acid × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSA4_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain O； PDBConstruct 1–261； UniProt 1–261 Author chain Z； PDBConstruct 1–261； UniProt 1–261

Proteasome subunit beta type-7

OrganismNot specified

UniProt P70195

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit beta type-6 × 2 （Q60692） Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit beta type-4 × 2 （P99026） Proteasome subunit beta type-3 × 2 （Q9R1P1） [(1R)-1-[(1-cyclohexyl-1,2,3-triazol-4-yl)carbonylamino]-3-methyl-butyl]boronic acid × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB7_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain B； PDBConstruct 1–234； UniProt 44–277 Author chain E； PDBConstruct 1–234； UniProt 44–277

Proteasome subunit beta type-4

OrganismNot specified

UniProt P99026

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit beta type-6 × 2 （Q60692） Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-3 × 2 （Q9R1P1） [(1R)-1-[(1-cyclohexyl-1,2,3-triazol-4-yl)carbonylamino]-3-methyl-butyl]boronic acid × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB4_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain W； PDBConstruct 1–264； UniProt 1–264 Author chain a； PDBConstruct 1–264； UniProt 1–264

Proteasome subunit beta type-3

OrganismNot specified

UniProt Q9R1P1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	Proteasome subunit beta type-6 × 2 （Q60692） Proteasome subunit alpha type-2 × 2 （P49722） Proteasome subunit alpha type-7 × 2 （Q9Z2U0） Proteasome subunit alpha type-6 × 2 （Q9QUM9） Proteasome subunit beta type-2 × 2 （Q9R1P3） Proteasome subunit beta type-1 × 2 （O09061） Proteasome subunit beta type-5 × 2 （O55234） Proteasome subunit alpha type-3 × 2 （O70435） Proteasome subunit alpha type-1 × 2 （Q9R1P4） Proteasome subunit alpha type-5 × 2 （Q9Z2U1） Proteasome subunit alpha type-4 × 2 （Q9R1P0） Proteasome subunit beta type-7 × 2 （P70195） Proteasome subunit beta type-4 × 2 （P99026） [(1R)-1-[(1-cyclohexyl-1,2,3-triazol-4-yl)carbonylamino]-3-methyl-butyl]boronic acid × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSB3_MOUSE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain U； PDBConstruct 1–205； UniProt 1–205 Author chain Y； PDBConstruct 1–205； UniProt 1–205

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8ypk
Deposition date deposition_date	2024-03-17
Structure title title	mouse proteasome 20S subunit in complex with compound 1
Keywords keywords	Inhibitor, complex, Proteasome, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8ypk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8ypk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8ypk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	59.95 Å
Rg (electron density)	59.59 Å
Total Rg	59.78 Å
Atom count	47992
Residues	6164
Excluded volume	856580 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8ypk__assembly_1__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (15)

Entity 1 Entity 1 polymer

Description description	Proteasome subunit beta type-6
Molecular weight formula_weight	22014.9 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,F
Atom count atom_count	47992

TTIMAVQFNGGVVLGADSRTTTGSYIANRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMCYRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGMTKDECLQFTANALALAMERDGSSGGVIRLAAIQESGVERQVLLGDQIPKFTIATLPPP

Entity 2 Entity 2 polymer

Description description	Proteasome subunit alpha type-2
Molecular weight formula_weight	25955.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,b

MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQEYTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNEDLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLAAIA

Entity 3 Entity 3 polymer

Description description	Proteasome subunit alpha type-7
Molecular weight formula_weight	27897.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,I

MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDIVVLGVEKKSVAKLQDERTVRKICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDDAIETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILNPEEIEKYVAEIEKEKEENEKKKQKKAS

Entity 4 Entity 4 polymer

Description description	Proteasome subunit alpha type-6
Molecular weight formula_weight	27405.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R,K

MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD

Entity 5 Entity 5 polymer

Description description	Proteasome subunit beta type-2
Molecular weight formula_weight	22935.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T,V

MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRVIDKDGIHNLENIAFPKRDS

Entity 6 Entity 6 polymer

Description description	Proteasome subunit beta type-1
Molecular weight formula_weight	26405.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,X

MLSTAAYRDVERELGMGPHGSAGPVQLRFSPYAFNGGTVLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLTLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD

Entity 7 Entity 7 polymer

Description description	Proteasome subunit beta type-5
Molecular weight formula_weight	22554.5 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,C

TTTLAFKFLHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYSSVSVP

Entity 8 Entity 8 polymer

Description description	Proteasome subunit alpha type-3
Molecular weight formula_weight	28442.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,Q

MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSANDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM

Entity 9 Entity 9 polymer

Description description	Proteasome subunit alpha type-1
Molecular weight formula_weight	29586.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,G

MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLDELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLDGLEERPQRKAQPSQAAEEPAEKADEPMEH

Entity 10 Entity 10 polymer

Description description	Proteasome subunit alpha type-5
Molecular weight formula_weight	26436.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,M

MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLMEPSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLALQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSSLQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKDI

Entity 11 Entity 11 polymer

Description description	Proteasome subunit alpha type-4
Molecular weight formula_weight	29512.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,Z

MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAVKVLNKTMDVSKLSAEKVEIATLTRESGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQREKDK

Entity 12 Entity 12 polymer

Description description	Proteasome subunit beta type-7
Molecular weight formula_weight	25280.0 kDa
EC 编号 ec_number	3.4.25.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E

TTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPFSVPNKKGTRLGRYRCEKGTTAVLTEKVTPLEIEVLEETVQTMDTS

Entity 13 Entity 13 polymer

Description description	Proteasome subunit beta type-4
Molecular weight formula_weight	29143.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,a

MEAFWESRAGHWAGGPAPGQFYRIPATPSGLMDPASAPCEGPITRTQNPMVTGTSVLGVKFDGGVVIAADMLGSYGSLARFRNISRIMRVNDSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARELVERCMRVLYYRDARSYNRFQIATVTEKGVEIEGPLSAQTNWDIAHMISGFE

Entity 14 Entity 14 polymer

Description description	Proteasome subunit beta type-3
Molecular weight formula_weight	22988.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y,U

MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPFICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPNMDPEHLFETISQAMLNAVDRDAVSGMGVIVHVIEKDKITTRTLKARMD

Entity 15 Entity 15 non-polymer

Description description	[(1R)-1-[(1-cyclohexyl-1,2,3-triazol-4-yl)carbonylamino]-3-methyl-butyl]boronic acid
Molecular weight formula_weight	308.2 kDa
Source method src_method	syn
Copy count entity_count	4

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.700 Å
Low-resolution limit resolution_low	172.540 Å
R factor r_factor	0.2858
R_work r_work	0.2858
R_free r_free	—

Resolution resolution	2.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	25513

mouse proteasome 20S subunit in complex with compound 1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Proteasome subunit beta type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit beta type-5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Proteasome subunit alpha type-5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer