8z9d

cryo-EM structure of PSII-LHCII megacomplex from spinach

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem II protein D1

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBA_SPIOL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–351； UniProt 1–351 Author chain AA； PDBConstruct 1–351； UniProt 1–351 Author chain Aa； PDBConstruct 1–351； UniProt 1–351 Author chain a； PDBConstruct 1–351； UniProt 1–351

Oxygen-evolving enhancer protein 1, chloroplastic

OrganismNot specified

UniProt P12359

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBO_SPIOL
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain O； PDBConstruct 1–332； UniProt 1–332 Author chain OO； PDBConstruct 1–332； UniProt 1–332 Author chain Oo； PDBConstruct 1–332； UniProt 1–332 Author chain o； PDBConstruct 1–332； UniProt 1–332

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt A0A9R0HRF2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0HRF2_SPIOL
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain R； PDBConstruct 1–286； UniProt 1–286 Author chain RR； PDBConstruct 1–286； UniProt 1–286 Author chain Rr； PDBConstruct 1–286； UniProt 1–286 Author chain r； PDBConstruct 1–286； UniProt 1–286

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt A0A9R0IJF3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0IJF3_SPIOL
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain S； PDBConstruct 1–295； UniProt 1–295 Author chain SS； PDBConstruct 1–295； UniProt 1–295 Author chain Ss； PDBConstruct 1–295； UniProt 1–295 Author chain s； PDBConstruct 1–295； UniProt 1–295

Photosystem II reaction center protein T

OrganismNot specified

UniProt P61840

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBT_SPIOL
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain T； PDBConstruct 1–33； UniProt 1–33 Author chain TT； PDBConstruct 1–33； UniProt 1–33 Author chain Tt； PDBConstruct 1–33； UniProt 1–33 Author chain t； PDBConstruct 1–33； UniProt 1–33

Photosystem II 5 kDa protein, chloroplastic

OrganismNot specified

UniProt A0A9R0J8H2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0J8H2_SPIOL
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain U； PDBConstruct 1–99； UniProt 1–99 Author chain UU； PDBConstruct 1–99； UniProt 1–99 Author chain Uu； PDBConstruct 1–99； UniProt 1–99 Author chain u； PDBConstruct 1–99； UniProt 1–99

Photosystem II reaction center W protein, chloroplastic

OrganismNot specified

UniProt Q41387

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBW_SPIOL
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain W； PDBConstruct 1–137； UniProt 1–137 Author chain WW； PDBConstruct 1–137； UniProt 1–137 Author chain Ww； PDBConstruct 1–137； UniProt 1–137 Author chain w； PDBConstruct 1–137； UniProt 1–137

Photosystem II reaction center X protein, chloroplastic

OrganismNot specified

UniProt A0A9R0JQ89

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0JQ89_SPIOL
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain X； PDBConstruct 1–117； UniProt 1–117 Author chain XX； PDBConstruct 1–117； UniProt 1–117 Author chain Xx； PDBConstruct 1–117； UniProt 1–117 Author chain x； PDBConstruct 1–117； UniProt 1–117

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt A0A9R0JBE4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0JBE4_SPIOL
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain G； PDBConstruct 1–267； UniProt 1–267 Author chain GG； PDBConstruct 1–267； UniProt 1–267 Author chain Gg； PDBConstruct 1–267； UniProt 1–267 Author chain N； PDBConstruct 1–267； UniProt 1–267 Author chain NN； PDBConstruct 1–267； UniProt 1–267 Author chain Nn； PDBConstruct 1–267； UniProt 1–267 Author chain Y； PDBConstruct 1–267； UniProt 1–267 Author chain YY； PDBConstruct 1–267； UniProt 1–267 Author chain Yy； PDBConstruct 1–267； UniProt 1–267 Author chain g； PDBConstruct 1–267； UniProt 1–267 Author chain n； PDBConstruct 1–267； UniProt 1–267 Author chain y； PDBConstruct 1–267； UniProt 1–267

Photosystem II reaction center protein Z

OrganismNot specified

UniProt Q9M3M6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBZ_SPIOL
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain Z； PDBConstruct 1–62； UniProt 1–62 Author chain ZZ； PDBConstruct 1–62； UniProt 1–62 Author chain Zz； PDBConstruct 1–62； UniProt 1–62 Author chain z； PDBConstruct 1–62； UniProt 1–62

Chlorophyll a-b binding protein CP24, chloroplastic

OrganismNot specified

UniProt P36494

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CB4_SPIOL
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain 4； PDBConstruct 1–259； UniProt 1–259 Author chain 44； PDBConstruct 1–259； UniProt 1–259

Oxygen-evolving enhancer protein 2, chloroplastic

OrganismNot specified

UniProt P12302

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBP_SPIOL
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain P； PDBConstruct 1–267； UniProt 1–267 Author chain PP； PDBConstruct 1–267； UniProt 1–267 Author chain Pp； PDBConstruct 1–267； UniProt 1–267 Author chain p； PDBConstruct 1–267； UniProt 1–267

Oxygen-evolving enhancer protein 3, chloroplastic

OrganismNot specified

UniProt P12301

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBQ_SPIOL
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain Q； PDBConstruct 1–232； UniProt 1–232 Author chain QQ； PDBConstruct 1–232； UniProt 1–232 Author chain Qq； PDBConstruct 1–232； UniProt 1–232 Author chain q； PDBConstruct 1–232； UniProt 1–232

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt A4F3R4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A4F3R4_SPIOL
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain 1； PDBConstruct 1–267； UniProt 1–267 Author chain 11； PDBConstruct 1–267； UniProt 1–267 Author chain 2； PDBConstruct 1–267； UniProt 1–267 Author chain 22； PDBConstruct 1–267； UniProt 1–267

Chlorophyll a-b binding protein, chloroplastic

OrganismNot specified

UniProt A0A9R0J656

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A9R0J656_SPIOL
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain 3； PDBConstruct 1–264； UniProt 1–264 Author chain 33； PDBConstruct 1–264； UniProt 1–264

Photosystem II 10 kDa polypeptide, chloroplastic

OrganismNot specified

UniProt P10690

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBR_SPIOL
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain 0； PDBConstruct 1–140； UniProt 1–140 Author chain 00； PDBConstruct 1–140； UniProt 1–140

Photosystem II reaction center proteins PsbY, chloroplastic

OrganismNot specified

UniProt P80470

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBY_SPIOL
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain 5； PDBConstruct 1–199； UniProt 1–199 Author chain 55； PDBConstruct 1–199； UniProt 1–199

Photosystem II CP43 reaction center protein

OrganismNot specified

UniProt P06003

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBC_SPIOL
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain C； PDBConstruct 1–473； UniProt 1–473 Author chain CC； PDBConstruct 1–473； UniProt 1–473 Author chain Cc； PDBConstruct 1–473； UniProt 1–473 Author chain c； PDBConstruct 1–473； UniProt 1–473

Photosystem II D2 protein

OrganismNot specified

UniProt P06005

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBD_SPIOL
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain D； PDBConstruct 1–352； UniProt 1–352 Author chain DD； PDBConstruct 1–352； UniProt 1–352 Author chain Dd； PDBConstruct 1–352； UniProt 1–352 Author chain d； PDBConstruct 1–352； UniProt 1–352

Cytochrome b559 subunit alpha

OrganismNot specified

UniProt P69383

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBE_SPIOL
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain E； PDBConstruct 1–83； UniProt 1–83 Author chain EE； PDBConstruct 1–83； UniProt 1–83 Author chain Ee； PDBConstruct 1–83； UniProt 1–83 Author chain e； PDBConstruct 1–83； UniProt 1–83

Cytochrome b559 subunit beta

OrganismNot specified

UniProt P60128

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBF_SPIOL
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain F； PDBConstruct 1–39； UniProt 1–39 Author chain FF； PDBConstruct 1–39； UniProt 1–39 Author chain Ff； PDBConstruct 1–39； UniProt 1–39 Author chain f； PDBConstruct 1–39； UniProt 1–39

Photosystem II reaction center protein H

OrganismNot specified

UniProt P05146

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBH_SPIOL
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain H； PDBConstruct 1–73； UniProt 1–73 Author chain HH； PDBConstruct 1–73； UniProt 1–73 Author chain Hh； PDBConstruct 1–73； UniProt 1–73 Author chain h； PDBConstruct 1–73； UniProt 1–73

Photosystem II reaction center protein I

OrganismNot specified

UniProt P62103

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBI_SPIOL
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain I； PDBConstruct 1–36； UniProt 1–36 Author chain II； PDBConstruct 1–36； UniProt 1–36 Author chain Ii； PDBConstruct 1–36； UniProt 1–36 Author chain i； PDBConstruct 1–36； UniProt 1–36

Photosystem II reaction center protein J

OrganismNot specified

UniProt Q9M3L2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBJ_SPIOL
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain J； PDBConstruct 1–40； UniProt 1–40 Author chain JJ； PDBConstruct 1–40； UniProt 1–40 Author chain Jj； PDBConstruct 1–40； UniProt 1–40 Author chain j； PDBConstruct 1–40； UniProt 1–40

Photosystem II reaction center protein K

OrganismNot specified

UniProt P12163

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBK_SPIOL
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain K； PDBConstruct 1–59； UniProt 1–59 Author chain KK； PDBConstruct 1–59； UniProt 1–59 Author chain Kk； PDBConstruct 1–59； UniProt 1–59 Author chain k； PDBConstruct 1–59； UniProt 1–59

Photosystem II reaction center protein L

OrganismNot specified

UniProt P60150

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein M × 4 （P62112） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBL_SPIOL
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain L； PDBConstruct 1–38； UniProt 1–38 Author chain LL； PDBConstruct 1–38； UniProt 1–38 Author chain Ll； PDBConstruct 1–38； UniProt 1–38 Author chain l； PDBConstruct 1–38； UniProt 1–38

Photosystem II reaction center protein M

OrganismNot specified

UniProt P62112

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II CP47 reaction center protein × 4 （P04160） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBM_SPIOL
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain M； PDBConstruct 1–34； UniProt 1–34 Author chain MM； PDBConstruct 1–34； UniProt 1–34 Author chain Mm； PDBConstruct 1–34； UniProt 1–34 Author chain m； PDBConstruct 1–34； UniProt 1–34

Photosystem II CP47 reaction center protein

OrganismNot specified

UniProt P04160

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 112	Photosystem II protein D1 × 4 （P69560） Oxygen-evolving enhancer protein 1, chloroplastic × 4 （P12359） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0HRF2） Chlorophyll a-b binding protein, chloroplastic × 4 （A0A9R0IJF3） Photosystem II reaction center protein T × 4 （P61840） Photosystem II 5 kDa protein, chloroplastic × 4 （A0A9R0J8H2） Photosystem II reaction center W protein, chloroplastic × 4 （Q41387） Photosystem II reaction center X protein, chloroplastic × 4 （A0A9R0JQ89） Chlorophyll a-b binding protein, chloroplastic × 12 （A0A9R0JBE4） Photosystem II reaction center protein Z × 4 （Q9M3M6） Chlorophyll a-b binding protein CP24, chloroplastic × 2 （P36494） Oxygen-evolving enhancer protein 2, chloroplastic × 4 （P12302） Oxygen-evolving enhancer protein 3, chloroplastic × 4 （P12301） Chlorophyll a-b binding protein, chloroplastic × 4 （A4F3R4） Chlorophyll a-b binding protein, chloroplastic × 2 （A0A9R0J656） Photosystem II 10 kDa polypeptide, chloroplastic × 2 （P10690） Photosystem II reaction center proteins PsbY, chloroplastic × 2 （P80470） Photosystem II CP43 reaction center protein × 4 （P06003） Photosystem II D2 protein × 4 （P06005） Cytochrome b559 subunit alpha × 4 （P69383） Cytochrome b559 subunit beta × 4 （P60128） Photosystem II reaction center protein H × 4 （P05146） Photosystem II reaction center protein I × 4 （P62103） Photosystem II reaction center protein J × 4 （Q9M3L2） Photosystem II reaction center protein K × 4 （P12163） Photosystem II reaction center protein L × 4 （P60150） Photosystem II reaction center protein M × 4 （P62112） CA-MN4-O5 CLUSTER × 4 FE (II) ION × 4 CHLORIDE ION × 8 CHLOROPHYLL A × 374 PHEOPHYTIN A × 8 BETA-CAROTENE × 44 ;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ; × 6 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE × 55 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 14 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE × 22 CHLOROPHYLL B × 140 (3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL × 38 ;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ; × 18 ;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ; × 14 DODECYL-ALPHA-D-MALTOSIDE × 4 DIGALACTOSYL DIACYL GLYCEROL (DGDG) × 20 BICARBONATE ION × 4 PROTOPORPHYRIN IX CONTAINING FE × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PSBB_SPIOL
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain B； PDBConstruct 1–508； UniProt 1–508 Author chain BB； PDBConstruct 1–508； UniProt 1–508 Author chain Bb； PDBConstruct 1–508； UniProt 1–508 Author chain b； PDBConstruct 1–508； UniProt 1–508

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8z9d
Deposition date deposition_date	2024-04-23
Structure title title	cryo-EM structure of PSII-LHCII megacomplex from spinach
Keywords keywords	PSII, LHCII, megacomplex, photosynthesis; PHOTOSYNTHESIS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8z9d__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8z9d__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8z9d__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	117.30 Å
Total Rg	116.90 Å
Atom count	339330
Residues	17260
Excluded volume	3158000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8z9d__assembly_1__model_1`	112-meric （112）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (46)

Entity 1 Entity 1 polymer

Description description	Photosystem II protein D1
Molecular weight formula_weight	38804.2 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,a,AA,Aa
Atom count atom_count	339330

MTAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDIDGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLLGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFNFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFNFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAAIEAPST

Entity 2 Entity 2 polymer

Description description	Oxygen-evolving enhancer protein 1, chloroplastic
Molecular weight formula_weight	35207.4 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Oo,O,o,OO

MAASLQASTTFLQPTKVASRNTLQLRSTQNVCKAFGVESASSGGRLSLSLQSDLKELANKCVDATKLAGLALATSALIASGANAEGGKRLTYDEIQSKTYLEVKGTGTANQCPTVEGGVDSFAFKPGKYTAKKFCLEPTKFAVKAEGISKNSGPDFQNTKLMTRLTYTLDEIEGPFEVSSDGTVKFEEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPESFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSKGTITLSVTSSKPETGEVIGVFQSLQPSDTDLGAKVPKDVKIEGVWYAQLEQQ

Entity 3 Entity 3 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	31046.3 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Rr,R,r,RR

MASASASAAATSSFIGTRLTEVPSNSGKVTCRFGFGAKKVAKKAQPKSGFSTDRPLWYPGAKAPEYLDGSLVGDYGFDPFGLGKPAEYLQYDYDGLDQNLAKNLAGDIIGTRTESADVKSTSLQPYSEVFGLQRFRECELIHGRWAMLATLGALTVEGLTGITWQDAGKVELIEGSSYLGQPLPFSMTTLIWIEVLVIGYIEFQRNAELDTEKRLYPGGTFDPLGLASDPEKKPILQLAEIKHARLAMVGFLGFAVQAAVTGKGPLNNWVTHLSDPLHTTILDRFL

Entity 4 Entity 4 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	31341.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ss,S,s,SS

MASVAASTAAACLGKSELLGNSLNLRSATSAPCSTPSVGPCKIVALFNFGKKAATPPAKSKAKVAVASPADDELAKWYGPDRRIFLPDGLLDRDDIPEYLNGEVPGDYGYDPFGLGKKPEDFAKYQAFELIHARWAMLGAAGCVIPEAFNKFGANCGPEAVWFKTGALLLDGNTLNYFGKNIPINLVLAVVAEVVLLGGAEYYRITNGLDFEDKLHPGGPFDPLGLAKDPDQAALLKVKEIKNGRLAMFSMFAFFIQAYVTGQGPVENLSAHLSDPFGNNLLTVIGGAAERVPTL

Entity 5 Entity 5 polymer

Description description	Photosystem II reaction center protein T
Molecular weight formula_weight	3825.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Tt,T,t,TT

MEALVYTFLLVSTLGIIFFAIFFREPPKISTKK

Entity 6 Entity 6 polymer

Description description	Photosystem II 5 kDa protein, chloroplastic
Molecular weight formula_weight	10676.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Uu,U,u,UU

MASITMTASFLGTTVSKQPPTHHLRRGVVMAKAMPETTTTTKEETSSKRRDLVFAVAAAAACSVARIAMAEEPKRGTPEAKKKYAPVCVTMPSARICYK

Entity 7 Entity 7 polymer

Description description	Photosystem II reaction center W protein, chloroplastic
Molecular weight formula_weight	14186.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ww,W,w,WW

MATITASSSASLVARASLVHNSRVGVSSSPILGLPSMTKRSKVTCSIENKPSTTETTTTTNKSMGASLLAAAAAATISNPAMALVDERMSTEGTGLPFGLSNNLLGWILFGVFGLIWALYFVYASGLEEDEESGLSL

Entity 8 Entity 8 polymer

Description description	Photosystem II reaction center X protein, chloroplastic
Molecular weight formula_weight	11958.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Xx,X,x,XX

MASISAVSMATPITTTTTKTTFFSPLPVVKPQRATLMGQKPRAMGLKVQASLKEKAVTGLTAAALTASMMVPDVAEAAELAPSLKNFLFSIAAGGVVLTAIVGAVVAVSNFDPVKRA

Entity 9 Entity 9 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	28433.4 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Yy,G,N,Y,g,n,y,GG,NN,YY,Gg,Nn

MASSTMALSSPSLAGKAVKLGPTASEIIGEGRITMRKTAGKPKTVQSSSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRIAGGPLGEVVDPLYPGGSFDPLGLADDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWNFATNFVPGK

Entity 10 Entity 10 polymer

Description description	Photosystem II reaction center protein Z
Molecular weight formula_weight	6541.7 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Zz,Z,z,ZZ

MTIAFQLAVFALIATSSILLISVPVVFASPDGWSSNKNIVFSGTSLWLGLVFLVGILNSLIS

Entity 11 Entity 11 polymer

Description description	Chlorophyll a-b binding protein CP24, chloroplastic
Molecular weight formula_weight	27693.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	44,4

MAAATSATAIVNGFTSPFLSGGKKSSQSLLFVNSKVGAGVSTTSRKLVVVAAAAAPKKSWIPAVKGGGNFLDPEWLDGSLPGDFGFDPLGLGKDPAFLKWYREAELIHGRWAMLAVLGIFVGQAWTGIPWFEAGADPGAVAPFSFGTLLGTQLLLMGWVESKRWVDFFDPDSQSVEWATPWSRTAENFSNSTGEQGYPGGKFFDPLSLAGTISNGVYNPDTDKLERLKLAEIKHARLAMLAMLIFYFEAGQGKTPLGAL

Entity 12 Entity 12 polymer

Description description	Oxygen-evolving enhancer protein 2, chloroplastic
Molecular weight formula_weight	28495.9 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Pp,p,P,PP

MASTACFLHHHAAISSPAAGRGSAAQRYQAVSIKPNQIVCKAQKQDDNEANVLNSGVSRRLALTVLIGAAAVGSKVSPADAAYGEAANVFGKPKKNTEFMPYNGDGFKLLVPSKWNPSKEKEFPGQVLRYEDNFDATSNLSVLVQPTDKKSITDFGSPEDFLSQVDYLLGKQAYFGKTDSEGGFDSGVVASANVLESSTPVVDGKQYYSITVLTRTADGDEGGKHQVIAATVKDGKLYICKAQAGDKRWFKGAKKFVESATSSFSVA

Entity 13 Entity 13 polymer

Description description	Oxygen-evolving enhancer protein 3, chloroplastic
Molecular weight formula_weight	24884.4 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Qq,q,Q,QQ

MAQAMASMAGLRGASQAVLEGSLQISGSNRLSGPTTSRVAVPKMGLNIRAQQVSAEAETSRRAMLGFVAAGLASGSFVKAVLAEARPIVVGPPPPLSGGLPGTENSDQARDGTLPYTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG

Entity 14 Entity 14 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	28429.2 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	11,22,1,2

MASSTMALSSPAFGGKAVKLNPSTSDMIGEGRISMRKSAGKPKNVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFSKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQSILAIWACQVILMGAVEGYRVAGGPLGEVVDPLYPGGSFDPLGLAEDPEAFAELKVKEIKNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWNFATNFVPGN

Entity 15 Entity 15 polymer

Description description	Chlorophyll a-b binding protein, chloroplastic
Molecular weight formula_weight	28512.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	33,3

MATMVSSSTVLTPNPFVGQGKGANGNTLRDVVPMGSGKFTMGNDLWYGPDRVKYLGPFSAQTPSYLTGEFPGDYGWDTAGLSADPEAFARNRALEVIHGRWAMLGALGCLTPEVLEKWVKVDFKEPVWFKAGAQIFSEGGLDYLGNPNLVHAQSILAVLGFQVLLMGLVESFRINGLDGVGDGNDLYPGGQYFDPLGLADDPVTFAELKVKEIKNGRLAMFSMFGFFVQAIITGKGPLENLLDHLDNPVANNAWVYATKFVPGS

Entity 16 Entity 16 polymer

Description description	Photosystem II 10 kDa polypeptide, chloroplastic
Molecular weight formula_weight	14409.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0,00

MATSVMSSLSLKPSSFGVDTKSAVKGLPSLSRSSASFTVRASGVKKIKVDKPLGIGGGMKLRDGVDSSGRKPTGKGVYQFVDKYGANVDGYSPIYNEEEWAPTGDVYAGGTTGLLIWAVTLAGLLAGGALLVYNTSALAQ

Entity 17 Entity 17 polymer

Description description	Photosystem II reaction center proteins PsbY, chloroplastic
Molecular weight formula_weight	20678.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	5,55

MAATMATTMAVLNTKCLTLNTNKTTSTSPKPTSKPISLSPLGLSNSKLPMGLSPIITAPAIAGAVFATLGSVDPAFAVQQLADIAAEAGTSDNRGLALLLPIIPALGWVLFNILQPALNQINKMRNEKKAFIVGLGLSGLATSGLLLATPEAQAASEEIARGSDNRGTLLLLVVLPAIGWVLFNILQPALNQLNKMRSQ

Entity 18 Entity 18 polymer

Description description	Photosystem II CP43 reaction center protein
Molecular weight formula_weight	51880.6 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,c,CC,Cc

MKTLYSLRRFYPVETLFNGTLTLAGRDQETTGFAWWAGNARLINLSGKLLGAHVAHAGLIVFWAGAMNLFEVAHFVPEKPMYEQGLILLPHLATLGWGVGPGGEVIDTFPYFVSGVLHLISSAVLGFGGIYHALLGPETLEESFPFFGYVWKDRNKMTTILGIHLILLGIGAFLLVFKALYFGGVYDTWAPGGGDVRKITNVTLSPSIIFGCLLKSPFGGEGWIVSVDDLEDIIGGHVWIGVICILGGIWHILTKPFAWARRALVWSGEAYLSYSLAALSVFGFIACCFVWFNNTAYPSEFYGPTGPEASQAQAFTFLVRDQRLGANVGSAQGPTGLGKYLMRSPTGEVIFGGETMRFWDLRAPWLEPLRGPNGLDLSRLKKDIQPWQERRSAEYMTHAPLGSLNSVGGVATEINAVNYVSPRSWLSTSHFVLGFFLFVGHLWHAGRARAAAAGFEKGIDRDFEPVLSMTPLN

Entity 19 Entity 19 polymer

Description description	Photosystem II D2 protein
Molecular weight formula_weight	39422.0 kDa
EC 编号 ec_number	1.10.3.9
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,d,DD,Dd

MTIAVGKFTKDEKDLFDSMDDWLRRDRFVFVGWSGLLLFPCAYFALGGWFTGTTFVTSWYTHGLASSYLEGCNFLTAAVSTPANSLAHSLLLLWGPEAQGDFTRWCQLGGLWAFVALHGAFALIGFMLRQFELARSVQLRPYNAIAFSGPIAVFVSVFLIYPLGQSGWFFAPSFGVAAIFRFILFFQGFHNWTLNPFHMMGVAGVLGAALLCAIHGATVENTLFEDGDGANTFRAFNPTQAEETYSMVTANRFWSQIFGVAFSNKRWLHFFMLFVPVTGLWMSALGVVGLALNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGIRAWMAAQDQPHENLIFPEEVLPRGNA

Entity 20 Entity 20 polymer

Description description	Cytochrome b559 subunit alpha
Molecular weight formula_weight	9393.5 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,e,EE,Ee

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITGRFDSLEQLDEFSRSF

Entity 21 Entity 21 polymer

Description description	Cytochrome b559 subunit beta
Molecular weight formula_weight	4502.4 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f,FF,Ff

MTIDRTYPIFTVRWLAIHGLAVPTVFFLGSISAMQFIQR

Entity 22 Entity 22 polymer

Description description	Photosystem II reaction center protein H
Molecular weight formula_weight	7735.0 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,h,HH,Hh

MATQTVESSSRSRPKPTTVGALLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNSSVLLDGISMN

Entity 23 Entity 23 polymer

Description description	Photosystem II reaction center protein I
Molecular weight formula_weight	4170.9 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i,II,Ii

MLTLKLFVYTVVIFFVSLFIFGFLSNDPGRNPGREE

Entity 24 Entity 24 polymer

Description description	Photosystem II reaction center protein J
Molecular weight formula_weight	4117.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,j,JJ,Jj

MADTTGRIPLWIIGTVAGILVIGLVGIFFYGSYSGLGSSL

Entity 25 Entity 25 polymer

Description description	Photosystem II reaction center protein K
Molecular weight formula_weight	6751.0 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,k,KK,Kk

MLNIFSLICLNSALYSSSFFFGKLPEAYAFLSPIVDFMPVIPLFFFLLAFVWQAAVSFR

Entity 26 Entity 26 polymer

Description description	Photosystem II reaction center protein L
Molecular weight formula_weight	4498.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,l,LL,Ll

MTQSNPNEQNVELNRTSLYWGLLLIFVLAVLFSNYFFN

Entity 27 Entity 27 polymer

Description description	Photosystem II reaction center protein M
Molecular weight formula_weight	3783.5 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,m,MM,Mm

MEVNILAFIATALFILVPTAFLLIIYVKTVSQND

Entity 28 Entity 28 polymer

Description description	Photosystem II CP47 reaction center protein
Molecular weight formula_weight	56207.9 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,BB,B,Bb

MGLPWYRVHTVVLNDPGRLISVHIMHTALVAGWAGSMALYELAVFDPSDPVLDPMWRQGMFVIPFMTRLGITNSWGGWSITGGTITDPGIWSYEGVAGAHIMFSGLCFLAAIWHWVYWDLEIFSDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQPVSPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSSSIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSFSEAWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPIFRDKEGRELFVRRMPTFFETFPVVLIDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKYARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFAGIDPDLDVQVEFGAFQKIGDPTTRRQGV

Entity 29 Entity 29 non-polymer

Description description	CA-MN4-O5 CLUSTER
Molecular weight formula_weight	339.8 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 30 Entity 30 non-polymer

Description description	FE (II) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 31 Entity 31 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 32 Entity 32 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	374

Entity 33 Entity 33 non-polymer

Description description	PHEOPHYTIN A
Molecular weight formula_weight	871.2 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 34 Entity 34 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	44

Entity 35 Entity 35 non-polymer

Description description	;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ;
Molecular weight formula_weight	749.2 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 36 Entity 36 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	55

Entity 37 Entity 37 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 38 Entity 38 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	22

Entity 39 Entity 39 non-polymer

Description description	CHLOROPHYLL B
Molecular weight formula_weight	907.5 kDa
Source method src_method	syn
Copy count entity_count	140

Entity 40 Entity 40 non-polymer

Description description	(3R,3'R,6S)-4,5-DIDEHYDRO-5,6-DIHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL
Molecular weight formula_weight	568.9 kDa
Source method src_method	syn
Copy count entity_count	38

Entity 41 Entity 41 non-polymer

Description description	;(3S,5R,6S,3'S,5'R,6'S)-5,6,5',6'-DIEPOXY-5,6,5',6'- TETRAHYDRO-BETA,BETA-CAROTENE-3,3'-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	18

Entity 42 Entity 42 non-polymer

Description description	;(1R,3R)-6-{(3E,5E,7E,9E,11E,13E,15E,17E)-18-[(1S,4R,6R)-4-HYDROXY-2,2,6-TRIMETHYL-7-OXABICYCLO[4.1.0]HEPT-1-YL]-3,7,12,16-TETRAMETHYLOCTADECA-1,3,5,7,9,11,13,15,17-NONAENYLIDENE}-1,5,5-TRIMETHYLCYCLOHEXANE-1,3-DIOL ;
Molecular weight formula_weight	600.9 kDa
Source method src_method	syn
Copy count entity_count	14

Entity 43 Entity 43 non-polymer

Description description	DODECYL-ALPHA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 44 Entity 44 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	20

Entity 45 Entity 45 non-polymer

Description description	BICARBONATE ION
Molecular weight formula_weight	61.0 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 46 Entity 46 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.22 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	93684

cryo-EM structure of PSII-LHCII megacomplex from spinach

1. Protein Identity and Related Structures Protein Identity & Related Structures

Photosystem II protein D1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Oxygen-evolving enhancer protein 1, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein T

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II 5 kDa protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center W protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center X protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Chlorophyll a-b binding protein, chloroplastic

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Photosystem II reaction center protein Z

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer