SAXSdb — 8zmz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Lactate-binding periplasmic protein TTHA0766,Red fluorescent protein drFP583

Thermus thermophilus HB8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	CALCIUM ION × 1 (2S)-2-HYDROXYPROPANOIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TLBP_THET8
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 38–227； UniProt 23–212 Author chain A； PDBConstruct 472–620； UniProt 213–361

Lactate-binding periplasmic protein TTHA0766,Red fluorescent protein drFP583

Thermus thermophilus HB8

UniProt Q9U6Y8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1	CALCIUM ION × 1 (2S)-2-HYDROXYPROPANOIC ACID × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RFP_DISSP
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 230–305； UniProt 146–221 Author chain A； PDBConstruct 334–467； UniProt 8–143

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	8zmz
Deposition date deposition_date	2024-05-24
Structure title title	Cryo-EM structure of R-eLACCO2 in the lactate-bound state
Keywords keywords	FLUORESCENT PROTEIN; FLUORESCENT PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

8zmz__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

8zmz__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

8zmz__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.44 Å
Rg (electron density)	28.95 Å
Total Rg	29.59 Å
Atom count	4425
Residues	547
Excluded volume	78905 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`8zmz__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Lactate-binding periplasmic protein TTHA0766,Red fluorescent protein drFP583
Molecular weight formula_weight	70044.5 kDa
Mutation mutation	mutant type
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	4425

MGGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPSSRMFSPMAVAQARRYKWRIQTAWDAGTVGYSLFQKFTERVKELTDGQLEVQPLPAGAVVGTFDMFDAVKTGVLDGMNPFTLYWAERMPVTAFLSSYALGLDRPDQWETWFYSLGGLDNARRAFAEQGLFYVGPVQHDLNTIHSKKPIRRFEDFKGVKLRVPGGMIAEVFAAAGASTVLLPGGEVYPALERGAVTAVSERMYPEDGALKSEIKKGLRLKDGGHYAAVVKTTYKAKKPVQLPGAYVVDIQLDIVSHNEDYTIVEQCERAEGRHSTGGVVELDKGGTGGSLVSKGEEDDMAIVKEFMRFKVHMEGSVNGHEFEIEGEGEGRPYEAFQTAKLKVTKGGPLPFAWDILSPQFXSKAYIKHPADIPDYFKLSFPEGFRWERVMYFEDGGIIHVDQDSSLQDGVFIYKVKLRGTNFPPDGPVMQKKTMGWERGRSAADFVGPAVNYNLGFHQEAKYIIMGPPETPAIHQPVDLMDFTINLNRWRSLPKPLQERFIAAVHEYSWIHYAGIQKANLEAWPKYRQAGVEVIRLGNEDVRKFRRLAIPIWFKWAKMDKYSREAFASQLEYMRGIGHVTDEELKGLSL

Source Source

Source organism organism	Thermus thermophilus HB8
NCBI taxonomy ID ncbi_taxonomy_id	300852
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	(2S)-2-HYDROXYPROPANOIC ACID
Molecular weight formula_weight	90.1 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.70 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	146454

Cryo-EM structure of R-eLACCO2 in the lactate-bound state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Lactate-binding periplasmic protein TTHA0766,Red fluorescent protein drFP583

State in the Current Structure

Other States of the Same Protein in the Database

Lactate-binding periplasmic protein TTHA0766,Red fluorescent protein drFP583

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8zmz__assembly_1__model_1

8zmz__assembly_1__model_1 | I(q)

8zmz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

7. Citations (1)

Cryo-EM structure of R-eLACCO2 in the lactate-bound state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Lactate-binding periplasmic protein TTHA0766,Red fluorescent protein drFP583

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Lactate-binding periplasmic protein TTHA0766,Red fluorescent protein drFP583

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

8zmz__assembly_1__model_1

8zmz__assembly_1__model_1 | I(q)

8zmz__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

7. Citations (1)