SAXSdb — 9c6r

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Detyrosinated tubulin alpha-1A chain

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Tubulin beta-6 chain × 8 （P09207） GUANOSINE-5'-TRIPHOSPHATE × 8 Cryptophycin 52 × 8 GUANOSINE-5'-DIPHOSPHATE × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBA1A_CHICK
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–451； UniProt 1–451 Author chain F； PDBConstruct 1–451； UniProt 1–451 Author chain K； PDBConstruct 1–451； UniProt 1–451 Author chain P； PDBConstruct 1–451； UniProt 1–451 Author chain U； PDBConstruct 1–451； UniProt 1–451 Author chain Z； PDBConstruct 1–451； UniProt 1–451 Author chain e； PDBConstruct 1–451； UniProt 1–451 Author chain j； PDBConstruct 1–451； UniProt 1–451

Tubulin beta-6 chain

OrganismNot specified

UniProt P09207

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Detyrosinated tubulin alpha-1A chain × 8 （P02552） GUANOSINE-5'-TRIPHOSPHATE × 8 Cryptophycin 52 × 8 GUANOSINE-5'-DIPHOSPHATE × 8	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TBB6_CHICK
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–446； UniProt 1–446 Author chain G； PDBConstruct 1–446； UniProt 1–446 Author chain L； PDBConstruct 1–446； UniProt 1–446 Author chain Q； PDBConstruct 1–446； UniProt 1–446 Author chain V； PDBConstruct 1–446； UniProt 1–446 Author chain a； PDBConstruct 1–446； UniProt 1–446 Author chain f； PDBConstruct 1–446； UniProt 1–446 Author chain k； PDBConstruct 1–446； UniProt 1–446

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9c6r
Deposition date deposition_date	2024-06-08
Structure title title	Blood cell-specific tubulin in complex with Cryptophycin-52
Keywords keywords	Tubulin Beta-6 chain, TBB6_CHICK, TUBB1, Ring C8, Hematopoietic isotype Cryptophycin, Anticancer, GTPase, Cytoskeleton, CELL CYCLE; CELL CYCLE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9c6r__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9c6r__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9c6r__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	117.30 Å
Total Rg	117.40 Å
Atom count	55352
Residues	6944
Excluded volume	978270 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9c6r__assembly_1__model_1`	16-meric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Detyrosinated tubulin alpha-1A chain
Molecular weight formula_weight	50188.4 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,F,K,P,U,Z,e,j
Atom count atom_count	55352

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVEGEGEEEGEEY

Entity 2 Entity 2 polymer

Description description	Tubulin beta-6 chain
Molecular weight formula_weight	50201.5 kDa
Source method src_method	nat
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,G,L,Q,V,a,f,k

MREIVHLQIGQCGNQIGAKFWEVISDEHGIDIAGNYCGNASLQLERINVYFNEAYSHKYVPRSILVDLEPGTMDSVRSSKIGPLFRPDNFIHGNSGAGNNWAKGHYTEGAELIENVMDVVRNECESCDCLQGFQLIHSLGGGTGSGMGTLLINKIREEYPDRIMNTFSVVPSPKVSDTVVEPYNAILSIHQLIENTDETFCIDNEALYDICFRTLKLTNPTYGDLNHLVSLTMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALSVPELTQQMFDARNMMAACDPRRGRYLTVACIFRGRMSTREVDEQLLSVQTKNSSYFVEWIPNNVKVAVCDIPPRGLKMAATFIGNNTAIQELFIRVSEQFSAMFRRKAFLHWYTGEGMDEMEFSEAEGNTNDLVSEYQQYQDATADVEEYEEAEASPEKET

Entity 3 Entity 3 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 4 Entity 4 non-polymer

Description description	Cryptophycin 52
Molecular weight formula_weight	669.2 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 5 Entity 5 non-polymer

Description description	GUANOSINE-5'-DIPHOSPHATE
Molecular weight formula_weight	443.2 kDa
Source method src_method	syn
Copy count entity_count	8

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.20 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	70192

Blood cell-specific tubulin in complex with Cryptophycin-52

1. Protein Identity and Related Structures Protein Identity & Related Structures

Detyrosinated tubulin alpha-1A chain

State in the Current Structure

Other States of the Same Protein in the Database

Tubulin beta-6 chain

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9c6r__assembly_1__model_1

9c6r__assembly_1__model_1 | I(q)

9c6r__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

7. Citations (1)

Blood cell-specific tubulin in complex with Cryptophycin-52

1. Protein Identity and Related Structures Protein Identity & Related Structures

Detyrosinated tubulin alpha-1A chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tubulin beta-6 chain

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9c6r__assembly_1__model_1

9c6r__assembly_1__model_1 | I(q)

9c6r__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

7. Citations (1)