9d2f

3D structure and atomic model of RS3 of mouse respiratory cilia

Method: ELECTRON MICROSCOPY D_max: 323.3 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Adenylate kinase 9

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain A； UniProt 1–1894	Not recorded	Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	KAD9_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1894； UniProt 1–1894

Leucine-rich repeat-containing protein 23

OrganismNot specified

UniProt O35125

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain B； UniProt 1–340 Chain C； UniProt 1–340	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	LRC23_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–340； UniProt 1–340 Author chain C； PDBConstruct 1–340； UniProt 1–340

Serine/threonine/tyrosine interacting-like 1

OrganismNot specified

UniProt Q9DAR2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain H； UniProt 1–321	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	Q9DAR2_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain H； PDBConstruct 1–321； UniProt 1–321

Cilia- and flagella-associated protein 91

OrganismNot specified

UniProt Q8BRC6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain N； UniProt 1–783	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	CFA91_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain N； PDBConstruct 1–783； UniProt 1–783

Actin, aortic smooth muscle

OrganismNot specified

UniProt P62737

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain O； UniProt 1–377 Chain R； UniProt 1–377	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	ACTA_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain O； PDBConstruct 1–377； UniProt 1–377 Author chain R； PDBConstruct 1–377； UniProt 1–377

Axonemal dynein light intermediate polypeptide 1

OrganismNot specified

UniProt Q8BVN8

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain P； UniProt 1–258 Chain Q； UniProt 1–258	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	IDLC_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain P； PDBConstruct 1–258； UniProt 1–258 Author chain Q； PDBConstruct 1–258； UniProt 1–258

Centrin-2

OrganismNot specified

UniProt Q9R1K9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain S； UniProt 1–172	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	CETN2_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain S； PDBConstruct 1–172； UniProt 1–172

Dynein axonemal heavy chain 1

OrganismNot specified

UniProt E9Q8T7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain U； UniProt 1–4250	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	DYH1_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain U； PDBConstruct 1–4250； UniProt 1–4250

Cilia- and flagella-associated protein 57

OrganismNot specified

UniProt Q9D180

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain W； UniProt 1–1249 Chain X； UniProt 1–1249	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	CFA57_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain W； PDBConstruct 1–1249； UniProt 1–1249 Author chain X； PDBConstruct 1–1249； UniProt 1–1249

Cilia- and flagella-associated protein 43

OrganismNot specified

UniProt E9Q7R9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain Y； UniProt 1–1682	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	CFA43_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain Y； PDBConstruct 1–1682； UniProt 1–1682

Cilia- and flagella-associated protein 44

OrganismNot specified

UniProt E9Q5M6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain Z； UniProt 1–1843	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	CFA44_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain Z； PDBConstruct 1–1843； UniProt 1–1843

Dynein, axonemal, heavy chain 6

OrganismNot specified

UniProt E9Q0B6

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain T； UniProt 1–4144	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	E9Q0B6_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain T； PDBConstruct 1–4144； UniProt 1–4144

MORN repeat-containing protein 5

OrganismNot specified

UniProt Q9DAI9

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain I； UniProt 1–170	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	MORN5_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain I； PDBConstruct 1–170； UniProt 1–170

Cilia- and flagella-associated protein 61

OrganismNot specified

UniProt Q8CEL2

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain J； UniProt 1–1252	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	CFA61_MOUSE
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain J； PDBConstruct 1–1252； UniProt 1–1252

Cilia- and flagella-associated protein 251

OrganismNot specified

UniProt E9Q743

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain K； UniProt 1–1299	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	CF251_MOUSE
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain K； PDBConstruct 1–1299； UniProt 1–1299

Tetratricopeptide repeat protein 29

OrganismNot specified

UniProt E9QLU4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain L； UniProt 1–471	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	E9QLU4_MOUSE
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain L； PDBConstruct 1–471； UniProt 1–471

Zinc finger, MYND domain containing 12

OrganismNot specified

UniProt A2BGJ5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain M； UniProt 1–363	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	A2BGJ5_MOUSE
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain M； PDBConstruct 1–363； UniProt 1–363

Malate dehydrogenase, cytoplasmic

OrganismNot specified

UniProt P14152

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain E； UniProt 1–334	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	MDHC_MOUSE
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain E； PDBConstruct 1–334； UniProt 1–334

Putative malate dehydrogenase 1B

OrganismNot specified

UniProt Q5F204

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain F； UniProt 1–500	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	MDH1B_MOUSE
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain F； PDBConstruct 1–500； UniProt 1–500

UPF0728 protein C10orf53 homolog

OrganismNot specified

UniProt Q3KNL4

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain V； UniProt 1–93	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	CJ053_MOUSE
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain V； PDBConstruct 1–93； UniProt 1–93

A kinase (PRKA) anchor protein 14

OrganismNot specified

UniProt Q3V0I7

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain a； UniProt 1–536	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	Q3V0I7_MOUSE
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain a； PDBConstruct 1–536； UniProt 1–536

cAMP-dependent protein kinase type II-alpha regulatory subunit

OrganismNot specified

UniProt P12367

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain b； UniProt 1–401	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 9D2F	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1L6E Solution structure of the docking and dimerization domain of protein kinase A II-alpha (RIIalpha D/D). Alternatively called the N-terminal dimerization domain of the regulatory subunit of protein kinase A. Deposited 2002-03-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–43（42 aa） Fragment：N-terminal docking and dimerization domain Chain B 2–43（42 aa） Fragment：N-terminal docking and dimerization domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 4；298 K；Ionic strength (raw mmCIF value) 0.012；Pressure 1 NMR measurement conditions pH 4；298 K；Ionic strength (raw mmCIF value) 0.012；Pressure 1 NMR measurement conditions pH 4；298 K；Ionic strength (raw mmCIF value) 0.012；Pressure 1 NMR measurement conditions pH 4；298 K；Ionic strength (raw mmCIF value) 0.012；Pressure 1 NMR sample composition 2mM dimer protein in 20 mM sodium phosphate buffer, 90%H2O-10% D2O, at pH 4 and temperature 298K \| 90% H2O/10% D2O NMR sample composition 1mM dimer protein 15N in 20 mM sodium phosphate buffer, 90%H2O-10% D2O, at pH 4 and temperature 298K \| 90% H2O/10% D2O NMR sample composition 1mM dimer protein 13C-15N in 20 mM sodium phosphate buffer, 90%H2O-10% D2O, at pH 4 and temperature 298K \| 90% H2O/10% D2O NMR sample composition Mixture of 2mM unlabeled and 2 mM 13C-15N labeled sample unfolded in 5 M guanadine hydrochloride and refolded in 20 mM sodium phosphate buffer, 90% H2O-10% D2O, at pH 4 and temperature 298K \| 90% H2O/10% D2O	Resolution not provided
1R2A THE MOLECULAR BASIS FOR PROTEIN KINASE A ANCHORING REVEALED BY SOLUTION NMR Deposited 1998-12-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 1–44（44 aa） Fragment：DIMERIZATION-ANCHORING DOMAIN Chain B 1–44（44 aa） Fragment：DIMERIZATION-ANCHORING DOMAIN	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 4；298 K；Ionic strength (raw mmCIF value) 0.012 mM；Pressure 1	Resolution not provided
2QVS Crystal Structure of Type IIa Holoenzyme of cAMP-dependent Protein Kinase Deposited 2007-08-08	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 92–401（310 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；295.5 K；1.9 M sodium formate, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 295.5K	Resolution 2.50 Å R-free 0.251

3 other PDB entries and 3 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	KAP2_MOUSE
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain b； PDBConstruct 1–401； UniProt 1–401

Ciliogenesis-associated TTC17-interacting protein

OrganismNot specified

UniProt B9EKE5

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain c； UniProt 1–520	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Adenylate kinase 7 × 2 （F8WIC0） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	CATIP_MOUSE
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain c； PDBConstruct 1–520； UniProt 1–520

Adenylate kinase 7

OrganismNot specified

UniProt F8WIC0

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 29 PDB declaration: 29-meric（29） Consistent with protein copy count	Chain D； UniProt 1–723 Chain G； UniProt 1–723	Not recorded	Adenylate kinase 9 × 1 （G3UYQ4） Leucine-rich repeat-containing protein 23 × 2 （O35125） Serine/threonine/tyrosine interacting-like 1 × 1 （Q9DAR2） Cilia- and flagella-associated protein 91 × 1 （Q8BRC6） Actin, aortic smooth muscle × 2 （P62737） Axonemal dynein light intermediate polypeptide 1 × 2 （Q8BVN8） Centrin-2 × 1 （Q9R1K9） Dynein axonemal heavy chain 1 × 1 （E9Q8T7） Cilia- and flagella-associated protein 57 × 2 （Q9D180） Cilia- and flagella-associated protein 43 × 1 （E9Q7R9） Cilia- and flagella-associated protein 44 × 1 （E9Q5M6） Dynein, axonemal, heavy chain 6 × 1 （E9Q0B6） MORN repeat-containing protein 5 × 1 （Q9DAI9） Cilia- and flagella-associated protein 61 × 1 （Q8CEL2） Cilia- and flagella-associated protein 251 × 1 （E9Q743） Tetratricopeptide repeat protein 29 × 1 （E9QLU4） Zinc finger, MYND domain containing 12 × 1 （A2BGJ5） Malate dehydrogenase, cytoplasmic × 1 （P14152） Putative malate dehydrogenase 1B × 1 （Q5F204） UPF0728 protein C10orf53 homolog × 1 （Q3KNL4） A kinase (PRKA) anchor protein 14 × 1 （Q3V0I7） cAMP-dependent protein kinase type II-alpha regulatory subunit × 1 （P12367） Ciliogenesis-associated TTC17-interacting protein × 1 （B9EKE5） ZN ZINC ION × 2	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；30 mM HEPES pH 7.4, 25 mM KCl, 5 mM MgSO4, 1 mM EGTA, 0.1 mM EDTA cryo-EM vitrification conditions：Cryogen ETHANE；4 microliters of splayed axoneme sample were applied to glow-discharged Quantifoil R2/2 Cu grids. After removing excess liquid by blotting the grid from the backside with Whatman filter paper for 2-3 s, the grid was immediately plunge-frozen in liquid ethane using a home-made plunge freezer.	Resolution 4.70 Å

Other States of the Same Protein in the Database

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	F8WIC0_MOUSE
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain D； PDBConstruct 1–723； UniProt 1–723 Author chain G； PDBConstruct 1–723； UniProt 1–723

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9d2f
Deposition date deposition_date	2024-08-08
Structure title title	3D structure and atomic model of RS3 of mouse respiratory cilia
Keywords keywords	axoneme, radial spoke, STRUCTURAL PROTEIN; STRUCTURAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	— Å
Radius of gyration Rg (electron density) rg_electron	161.90 Å
Forward intensity I(0) i0	22762900000.00
Molecular weight molecular_weight	1310600.0 kDa
Excluded volume excluded_volume	1647300 Å³
Envelope volume envelope_volume	4513900 Å³
Hydration-shell volume shell_volume	238010 Å³
Envelope diameter envelope_diameter	499.7 Å
Shell Rg shell_rg	117.20 Å
Envelope Rg envelope_rg	153.00 Å
Shape Rg shape_rg	161.90 Å
Total Rg total_rg	161.80 Å
Total atoms total_atoms	184242
Residues n_residues	11386
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	323.3 Å
Rg (real space) rg_real	113.60 Å
Rg uncertainty (real space) rg_real_error	1.55 Å
I(0) (real space) i0_real	1.6940e+10
I(0) uncertainty (real space) i0_real_error	3.9970e+08
Rg (reciprocal space) rg_reciprocal	110.40 Å
I(0) (reciprocal space) i0_reciprocal	18880000000.0000
Solution quality estimate total_estimate	0.8110
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	107.8 Å
Skewness Skewness skewness	0.374
Kurtosis Kurtosis kurtosis	-0.761
Angular range angular_range	— – 0.0450 Å⁻¹
Current regularization parameter α current_alpha	3.4540
Highest regularization parameter α highest_alpha	655900000.0000
Real-space data points n_real_points	10
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.104; Oscil: 0.993; Stabil: 0.861; Sysdev: 1.000; Positv: 1.000; Valcen: 0.973; Smooth: 0.007

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (25)

Entity 1 Entity 1 polymer

Description description	Adenylate kinase 9
Molecular weight formula_weight	219835.4 kDa
EC 编号 ec_number	2.7.4.3
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	184242

MASEEKTEELHPFTDIFNEDETDRNCLLSKPTCFIIFGKPGAGKTTLARNIAQAWKCIRVEALSVLEEHIAAEKETGAMLQSLLVSGHSIPDELVTKLILEKIKSPEVAHFGYILTEMPSLAQDNMTSLKQIELVKNLELQPDIIINIKCSDYDLCQRTCGQRQHSTTGYVYTREQWDPEIIESRRRKKRDFPKEGKSEEEEEEEEQEEEEAFIAEMQMVAEILQHLVQRPEDYLENVEITVKLYKELLLSALEEVMAEHNPQYLIELDGNKSPEELFMTVIERLKYLNVRRAAVITKLQGTEEEMTDIIDTEELFRTVSSYKLIAPRYRWYRSKWARSCPVSLKDGNIYSGAADYTVSFLGKMYCLSSEETLKLFSLNPRPFLLPPMPLPPCKVFIFGPEHIGKTTLANLIAEHFKAKVIDYAKLVQPRFDSAREKLIKDTITEATNTAIKVVQQRLLNEKQAKQQEERTLKELQVQYSKREYNDFLSKSSEELPSLENTGSKLSSLEIGQEDKSKSETTITGDQVKDVSTEESIEEVTENHPEVFAILEDTLRHAKELNFEQPHDKQAEILEEVIKETEDNKNRFPGAPKHGGWIVENFPLVRELWLSLIEKALLPDLVVYLSDAESNGKHVLNRLYLKNKAEIDGKILERLQEEAQAKKREEEEIRKVKEEELRLEEEKQRLMELATKKSKGRHRLTTLVAHHLALPYPDYPDNEAEEEVEDSEIHEESEAQEIPEYTRGSSLPEASETSETPEGDHEPEAEFKPPGDTAVEAETEKDPKEGLGSEDLLKVMLPEFPEDGYPNVPEMEPLKEVLNNHILSWKQLEQTIMDNVVSTLTVDVSNKTPQELLQRVVETMERPFKYSAWELNAEDYEEEAEDYQAETEIDEEQEEEEEEEEEGEEKIKEKRRHMGDTKHFCPVVLKENFVLQPGNPDEAVKYREKIYYFSSTEAKEKFLEHPEDYVSQNEPLKAPPLRICLLGPHGSGKTVCARKLAENFGIFHIQFDEFLQEKMLLKAERKFGPEFEDDSEEEQLVKQELEELAAQANVKIEEDTTKKQLPDVQLTEEEEAIKLSLTDNEPLPSEILDSILSEWWLKEPIRSTGFILDGFPRHPEEAQFLGERGFFPDAAVIIQVDDQDIFDRLLPAQVQKWKTKQHKKLERKKLIKDLKTKIKEDMVAKRRAELILEREKKRREDGTFRDEDEFSDEDADYEDDIENILEEEFPKDEEEMSEEDEEQEADATERLRNELGEKFETETNNIQSIQDEFDKVLIPIIMVNGARKMHIVQYVMNMKLKPLVENRESIFEKCYPVSSHLAHKMLSYTYKHMSSFGYWDPVKLSEGETIKPVENAENPLNPVIHRHYIYFLSNKQTKEKFMMNPIKYIRQPKPKATMPVRIMIVGPPKSGKTTVAKKLASDYGLRCLSVGDALRGMLNNHPDSELSLMLNWHLHKGKTVPDELAIQALDISLMESVCNTIGVVIDGYPVTPHQMDLLEARSIIPMVIFELHVPSKEIFKRLLLEKKTEQSMSYPLHNSSQIIAYKNAKYHKNINEIRQFYQKQHQNWHVIDGFHSKWWVWNEVLKDIQQMNKYIQTYMKKIKEGKAACIDKLCITPEELIARLGEFKQFCPVSLAESNELIDCSVTSSLEFAAEFRGHYYKMSSQEKLNKFLKDPELYVPPLAPHPLPPDDLLPKRLTLSELKSRFPKCAELQGYCPVTYQDGKQRYEALVPGNIRYALEYRNCIYICESEEKLQKFMRSPMQYWNQKLPRKLPPLKESIHLTSLPLPGYLEQGTATSLIKAMNAAGNLKPKLPFLSVRRSVLLYIAFHLKAFNPKGSEYSRKKYKKKLEQFVERCELITYLSSKMTRKYKEPQFRAIDFDHKLQTFLSLKNIDPVTG

Entity 2 Entity 2 polymer

Description description	Leucine-rich repeat-containing protein 23
Molecular weight formula_weight	39338.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C

MSDEDDVDDVDAEQDEVESDKEIEEWEDYRKETEEASEEWLPTPITEAMMKEGLSLLCKIGSGLAHAYIKLEAKDRDLTDISLLRSYIHLRYVDISENHITDISPLNSLTHLLWLKADGNQLRSARMNELPYLQIASFSYNQIIDTEGIFHPRLGSLDLKGNRIHQVTGLDPERLSSLHTLELRGNQLESTKGIYLPKLKNLYLAQNLLKKVEGLENLSNLTTLHLRDNQIETLNGFSQEMKSLQYLNLRSNMISDLAELAKLRDLPKLRALVLLDNPCADETDYRQEALVQMAHLERLDKEFYEDDDRAEAEEIRQRLKEEQDQDLDPDQDMEPYLPPV

Entity 3 Entity 3 polymer

Description description	Serine/threonine/tyrosine interacting-like 1
Molecular weight formula_weight	37712.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MADLLFCEPTELYNILNQVSKLSRLAEPNYLCLLDVRSKRQYDESHVITALRVKKRDHQYLIPESVDLECVRYCIVYDSNTSSLELCIRRQLEEEEEEEEVEREDKEEDTELLPGPAVEFGQILIHFTRQPVYVLRGGYECFSGMYHFFRTQKIIWMPQELDAFQPYPVEILPGRVYLGKISQACNAKMHKDLKIKAHVNISMETTPYFIGNADKLLHIKLEDSPDTLLFDYFRHICHFIELHLRLHSVVLVFSTRGISRSVAAVVALLMHYNEETLKRSWAQVKKCKTNMRPNRAFVAQLLEWEKVLHGEYLTDISEPIY

Entity 4 Entity 4 polymer

Description description	Cilia- and flagella-associated protein 91
Molecular weight formula_weight	91764.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MSQTVTIQEPRPNDQRIPYQCREVRRAKGGFANRTYDYLYDPLFIVSSERDHAQANIQATLIRSRLKKVPNFRSMFSNLFHHPRYSMYWSKTDPVPLHVTREWRGQEAKHKEVLRLQAAMDTSFQMPKEKDEDPDVSGKNRYKFFDRPFLPFLQQMPLNVVLSPVKTQPLLLTPESSKYAIIPTKSTVATQTDYRDADVQTDPYSPEYVVCQDTIPELLTLANLTWGRGLPAGQAEVEIIERAREKRAWEATLPPLNDSVQAEKRRKMMNAMERKEWAFREGEIEKLQELRLEVLKQLLKRREEDQNELNMRHLNDQWYKLQEAKEAKVAQIRHKHVSDIRKLMGKGKNIEGKLQRRDIISDYSNFASQVYGPLSRLGRFPDNNSEDFVVRNHYLNTYEGLVELESSLPDFVTQPRIKPPKPQIITTKAGFLKRTARMDYELAEVHKALVDKKNKGLEGTKSLRFLQKNPISQARLPTPSLEMTSYEEGEIEMAVIYLQKLLRGRVVQNMMFEGKEKRLELILELRTSHALQEDDKLVKKAEKQVTLALQRQRNLHEDKLSVIENHLGDLEGRVLADMFDFLSKELVRLQEERRIHAFAMLAERQRRMREAEESGRRQVEQKRLQQEDMIFKEVIKVHQSTVTSYLEDIILNTEERTAEEQARKEIEKIAEEINNIAYEMENRRTYLQSEEIVAELVYSFLIPEVQKDFVKEKVRNAQRKHILAAHEIIHSNTETMLEEQVYKELQSEDFELEEEAESLDSEVPTVSVSKTSTIKPTQDEGEG

Entity 5 Entity 5 polymer

Description description	Actin, aortic smooth muscle
Molecular weight formula_weight	42054.9 kDa
EC 编号 ec_number	3.6.4.-
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O,R

MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF

Entity 6 Entity 6 polymer

Description description	Axonemal dynein light intermediate polypeptide 1
Molecular weight formula_weight	29724.0 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P,Q

MIPPADSLLKYDTPVLVSRNTEKRSPTARPLKVTIQQPGPSSTSPQPPKAKLPSTSCVPDPTKQAEEILNAILPPREWVEDTQLWIQQVSSTPSTRMDVVHLQEQLDLKLQQRQARETGICPVRRELYSQCFDELIREVTINCAERGLLLLRVRDEIHMTIAAYQTLYESSVAFGMRKALQAEQGKSDMERKITELETEKRDLERQVNEQKAKCEATEKRESERRQVEEKKHNEEIQFLKRTNQQLKAQLEGIIAPKK

Entity 7 Entity 7 polymer

Description description	Centrin-2
Molecular weight formula_weight	19827.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MASNFKKTTMASSAQRKRMSPKPELTEDQKQEIREAFDLFDADGTGTIDIKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFSDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVNEQEFLRIMKKTSLY

Entity 8 Entity 8 polymer

Description description	Dynein axonemal heavy chain 1
Molecular weight formula_weight	487618.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MEECNKEGPSSSSQGPGYCPVKVPESHDLEKILQESNYHPERNPLNPDPKTPPLPLTDLRQPRKSPLTGTDKKYPLMKQRGFYSDILSPGTLDKLGNVCCGPYMSQNLIRQADLDKFTPKVDSFVIPEDFQERVEQQIIGATTRLLTQTDFPLQSYEPKVQVPFQVLPGQCPRKIEIERRKQQYLRLDIEQLLTSEGIDSNKLMPRHPDLQHPQTIEQGRDPLFPIYLPLKVFDNEEFDCRTPTEWLNMGLEPGSQNRKPVPGKALLPTDDDLGHEDPKNQELDYRWCEVGVLDYDEEKKLYLVQKTDKRGLVRDEMGMPILNGGITPAGRPPLLATQYWVPRIQLLFCAEDPRVFTQRVVQANALRKYTEALLMYNLYVDCMPTEGRRVINEQSLSKIKQWALSTPRMRKGQSVLEHLSCLAREVNLDYERSMNKINFDQIVSSNPETFSYVTLPEKEEEKVPNQGLVSVPEYPFREQKEDFTFVSLLTRPEVITALSKVRAECNKVTSMSLFHSSLSKYSRLEEFEQIQSQTFSQVQMFLKDSWISTLKVAMRGSLRDMSKGWYNLYETNWEVYLMSKLRKLMELIKYMLQDTLRFLVQDSLGSFTQFIGDACCSVLECVDDMDWGEDLVNSPYKPRKNPLFIVDLVLDNSGVHYSTPLEHFEMILLNLFDKGILATHAVPQLEKLVMEDIFISGDPLLESVGLHEPLVEELRANITNAMHKAMMPLQAYAKEYRKYLELNNNDISTFLKTYQTQCPSAEEVREVVITHLKEKEILDNSLPSSIIIGPFYINVDNVKQSLSKKRKALATSMLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAELRDWMKGIPEKLVFLEERIVKVMSDYEVMDEFFYNLTTDDFNDKWAANNWPSKILGQIDMVRQQHVEDEEKFRKIQLMDQNNFQEKLEGLQLVVAGFSIHVEIARAHEIANEVRRVKKQLKDCQQLAMLYNNRERIFGLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVIESFKTMHKCVKQFKDIPACQEVALDIRTRIEEFKPYIPLIQGLRNPGMRNRHWEVLSNEININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSSILFNVLPYKETDTYILKSPDEASQLLDDHIVMTQSMSFSPYKKPFEQRINSWETKLKLTQEVLEEWLNCQRAWLYLEPIFSSEDITRQLPVESKRYQTMERIWRKIMKNAYENREVINVCSDQRLLDSLRDCNKLLDLVQKGLSEYLETKRTAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGEEVKLSFSIYPSSNVEDWLLEVERSMKASVHDIIEMAIKAYPTMLRTEWVLNWPGQVTIAGCQTYWTMEVAEALEAGNISSKLFPQLSKQLSDLVALVRGKLSRMQRMVLSALIVIEVHAKDVVSKLIDENVVSVHDFEWISQLRYYWTKDDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNEANVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENPTMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEETDYGILDQAIRRSCEKNNLKDVEGFLIKCIQLYETTVVRHGLMLVGPTGSGKSNCYRVLAAAMTLLKGKPSISGGVYEAVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSLIRAGAIASDTNKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFVECWLKRLPAIIKPYEEQFKSLFTKYLENSINFVRNTVKEVIASTNSNLTMSLLKLLDCFFRPFLPREGLKKIPSEKLSHIPELIEPWFIFSLVWSVGATGDHTSRISFSQWLRLKMRLEQVKLGFPEDGLVYDYRLDDAGISSTEDDDEEEDENKQVSWVKWMDYSAPFTMMPDTNYCNIIVPTMDTVQMSYLLGMLLTNHKPVLCIGPTGTGKTLTVSNKLLKYLPLEYISHFLTFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKVIGAFKNLVDINFVCAMGPPGGGRNAITPRLTRHFNYLSFIEMDEVSKKRIFSIILECWMDGLLGEKSYREPVPGAPNIDDLTEPLVDATINVYGIITSQLLPTPAKSHYTFNLRDLSKVFQGMLMAEPSKVEDKVQLLRLWYHENCRVFRDRLVNEEDRSWFDELLEAQMEEFGVAFNKVCPFQPILYGDFMSPGSDVKSYELITSESKMMQVIEEYMEDYNQINTAKLRLVLFVDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWREDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNIYSADEQDQIINTMRPYIQEQGLQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATTFLSEIPELECSEEVIQGLIQVCVFIHQSVASKCVEYLAELARHNYVTPKSYLELLNIFSILIGQKKMELKTAKNRMKSGLDKLLRTSEDVAKMQEELEIMRPLLEEAAKDTMLTMEQIKVDTAIAEETRKSVQAEEIKANEKANKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGSKVDDYWEPGKGLLQDPGRFLESLFKFDKDNIGEAVIKAIQPYIDNEEFQPAAIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALREAQDDLEVTQRILEEAKHHLHEVEDGIATMQAKYRECVAKKEELEMKCEQCEQRLGRADKLINGLADEKVRWQETVENLENMLDNIFGDVLVAAGFVAYLGPFTGQYRTTLYEYWVNQLTVHHVPHTSKPTLITTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQGQANKWIKNMERESGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNIVLKLGDTVIPYHEDFRMYITTKLPNPHYSPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIVSNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAVRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRIVNINRYLTFSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQAEWRYLLSGGSIQTMFENPAPQWLSDRAWRDILALSNLPTFATFSNDFVMYLSEFQAIFDSAEPHRELLPGIWNAYLDEFQKLLILRCLRGDKVTNAMQDFVATHLEPRFIEPQTANLSAVFKESNSTTPLIFVLSPGTDPAADLYKFAEEMKFSKKFSAISLGQGQGPRAEAMMRNSIERGKWVFFQNCHLAPSWMPALERLIEHINPDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVKANLLKSYNSLSDDFLHSCQKVVEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYEDIPYKVLKYTAGEINYGGRVTDDWDRRCVMNILEDFYNPAVLSSEHSYSNSGIYHQIPPTYDLNGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALFNAILQLQPKSSSMGGQSREELVEDVAENILLQVPGPIELQEVTKKFPVLYEESMNTVLVQEVIRYNKLLEVITQTLSDMLKAIKGLVVMSLELELMSISLYNNTVPELWKSKAYPSLKPLASWIMDLLLRLDFMHSWINDGIPPVFWISGFFFPQAFLTGTLQNFARKFVISIDTITFDFKVLPEASSEIKERPQTGCYIHGLFLEGARWDSMNFQLAESRPKELYTEMAVIWLLPEANRKVQNQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPSNQPQRHWIKRGVALICALDY

Entity 9 Entity 9 polymer

Description description	Cilia- and flagella-associated protein 57
Molecular weight formula_weight	145133.3 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W,X

MSTVVAQALHVFGLRPHVTNNVFFFDEQIIIFPSGNHCVKYNIDQKWQKFIAGSDKSQGMLALAISPNRRYLAISETVQEKPAVTIYELSSIPCRKRKVLNNFDFQVQKFTSMAFSPDSKYLLTQTSPPDSNLVYWLWEKQKVMAIIKADSQNNPIYQVSISSQDNSQVCITGSGVFKLLRFAEGTLKQINFQRGESSNYLAHAWVSEDRVIVGTDTGKLFLFESGDQRWETSIMVKESTSSRSLEVIQESESLIEFPPLSSPVSSVERMDITTNTQQQAMPQVFAIAAYSKGFACSAGPGRVLLFEKVEEKDFYRESREIRIPTDQQSNDPSQSDKQDVLCLCFSPSEETLIASTNKNQLYSITMSLTEISKGEAAHFEYLLYPLHSASITGLDTCIRKPLIATCSLDRSVRIWNYESNTLELYKEYQEEAYTVSLHPSGHYIVVGFADKLRLMNLLIDDIRPFKEYSVRGCKECSFSNGGHLFAAVNGNVIHIFTTTSLENINILKGHTGKIRSLVWNLDDSKLVSAGTDGAVYEWNLSTGKRETECVLKSCSYNSVTTSPDAKVIFAVGSDQTLKEISDSLILREIPAFDVIYTSITISHSGRMIFVGTSVGTIRAMKYPLSLQKEYNEYQAHAGPVMKMLLTFDDQFLLTVGEDGCLFTWKVFDKDGRGIKREREVGFAEEVLVTKTDMEEKAQIMLELKTRVEELKMENEYQLRLKDMNYTEKIKELTDKFIQEMESLKTKNQVLKTEKEKQDISHRERLEELVDKQTRELQDLECCNNQKLLLEYEKYQELQLKSQRMQEEYEKQLRDNDETKSQALEELTEFYEAKLQEKTGLLEEAQEDVRQQLREFEETKKQIEEDEDREIQDIKTKYERKLRDEKESNLRLKGETGIMRKKFSSLQKEIEERTNDIELLKSEQMKLQGIIRSLEKDIQGLKREIQERDETIQDKEKRIYDLKKKNQELEKFKFVLDYKIKELKKQIEPRENEIKVMKEQIQEMEAELERFHKQNTQLELNITELLQKLRATDQEMRKEQQKERDLEALVRRFKTDLHNCVAYIQEPGLLKEKIRGLFEKYVQRADMVEIAGLNSDLQQEYARQREHLERNLATLKKKVIKEGELHRTDYVRIMQENVSLIKEINELRRELKLTRSQIYDLESALKVSKKTRSQEVPESVISKDVVGSTSTMRLNEQEETGRIIEMQRLEIRRLRDQIQEQEQVPGFHTIAGVRLPSIVDSDVDFEVHTK

Entity 10 Entity 10 polymer

Description description	Cilia- and flagella-associated protein 43
Molecular weight formula_weight	193674.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MSQDPERDDVTASATASASASAPASASAHYSGSSLSVRWVQGFPSQNVHFVNDQTICYPSGNFVIFINLETKKKTVLQCINGIVGVMATNVPSEVVAFSDRRFKPVIYIYSFPSLTRKNKLKGDILLDYTLLCFSYCGTYLASYSSLPEFELALWNWEASAILCKKSNPGMDVSQMSFNPMNWHQMCLSSSSAMSVWTIERSNQEHHFRIRSVKLPLEDATFLNEPDMLFPTTLPKDLIYGPVLPLSAIAGLVGEEAETFRPKDDIYPLLHPTMHCWTPSSDLYVGCEEGHLLMINTETLKVTVLQKAEEFPLPDGAPLINPLTLVYQKDGILASGIDGVIYSFIIKDSKYQVKTFLEFDGPVTHLVFSPSYKMLLIQTDKGSVYIYTFGAEMPLDKLLDACDGKVQAVSFITPGTKYFLTLTSSGEVSTVSLEDCNCTSRIFLKTQATALACSPSSPTAAVGTVDGYVYFLNILDVESPQMIHQAFLSQSPVKIVTYDQRGIFLLVGTEEGNIFVIDARPSKSFQIFGFTETGKDILQISTVSVMESDVVEVLVLYPLPDMGRSRLEYFTLPVMLPEVVPENFSDERGRLKDDLTHKYLYEVEHTLSSAVLGFTGSKIFGFCSQVPYICSYVMPVKEHTGVLVLKPHQKVQSKQYGSGTIYLSSHGLWLMTIAKCGILCIRDMFSMETFVRCRSHSHQGRGIQNMKMSLDGQHILVNGKDDNTLVCLKWKRLGANIASEIFEHSRPLVLHLSQTVESESVYLALSRESTNEQQEETTESQKHLNSDSSEEEAVIDHKMIPWIQQKMEEAIKKEVRIFSPRRKEIKRGIKELAQVIAMMMEENEKVDIIAKLDEQEFCLDADELERLHDECEEEVAKIRKDVEMHNLAQSYLTELIKEECWNSMAVKGRALKCFHIPYVVDNFPMKERTEEELQELSKVMQQKKTEIECLKLRKEIVEVQATTTIAKKHHEEEEEEEEDEERTIKTTSLPNYLLGSLSTDFGADTSLLTSQLDLHSREEKINQIILLKDIIYNIKRNFNSEFDAAYKQKEIEIARVKEKNVRIAEIISDLELEETVWQPVFEDSEKPERALVVEDDEISFKKYIAPWQRAKIKEVVSTYEMERLQQARISDERQRGLMDMMGGVLEVKKEDILRMVIPQPPFMAKADALWSEDERKQFKEYEKKVKELNEERDKYRKSLEAELKKLQNSIQESTQNFDDHLKRLFERRVKAEMVINQEELKINNIIFSLLLDEELSSREQFLNNYLLKKQEEKTKTAEAIQKAREDLDVFKEHHDMLVAEDKILDRSFKKEFSDILGHQVDVLYKLFKRRPRVHKQKTQADVTSLVPYGERPGSAKLNKENLAQLMKSMDELDNINNMPEGLDPSVWEHFCSTRRAKVENEYKVKQKAACLLEMTTFLRKRMEEDDVVHHEIEKVFHELIRLQDEKVRFQVNLTVQILLKQGQVELENFQLMLEYSDAILINKNIIEDLNSVIRTQGQKKVASMMESKEVHKGIYQIEWEHKKMEMEMEDLNQRAWDIEMLFFSRDRQKYLNEPNYENVIAIQIGIMEQTISVIDKTHKKNVENCKKLLKKLGKYSNQKDVANYTLSCNLREELVAVSERQDICNEIGSKLTCEKIARERYDNQLKQQKLLNISKQQAEQISILQAEVERLRMKTFPALIPM

Entity 11 Entity 11 polymer

Description description	Cilia- and flagella-associated protein 44
Molecular weight formula_weight	211840.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MKEPDDQDTSDGGRSGSRNEGKLAHKSILKSSQDTTADSYTDGEESYLGDDLDLDDMDESSHSSQEYVQAPAPSQEPPVEVKEEPEADVKKVLSETFYYDYPELVSIPYVSSEERIPLYFLTLNHSFGYDCRKRANLQLLDSNTLLYVAGNQMVLLDFKDKTQIYLQSSSGQGIGAIGVHPKKTYFAVAEKGSFPKIIIYEYPSLKPYRILRDGAEKAYAYVDFNNEGNLLASVGCHPDYTITIWGWKEEQPILRTKAFSQDVFKVTFNPDNDEQLTTSGSGHIKFWEMAFTFTGLKLQGSLGRFGKTSTSDIEGYAELPDGKVLSGSEWGNLLLWEGSLIKVELCRTGMKSCHSGSINQIMLDEGEVITAGSDGSVRIWDFETIDTADVIDDTGLLEIEPINELHIDKSVNLFSMIKMNEVGNNFWLAQDANGAIWKLDLSFSNITQDPECLFSFHSGPIAALAVSPLTYLMATTAMDCSVRVYDFSSKNPLVHMKFKQGGTSLIWAPRSVSVSASQIVVGFQDGVVRVLELFDPKGLTVYAGRKKIPDAELHLKYVFKPHTDEVTALAYERDGDILATGSEDKTVFFFDVEKEYKPIGFFNTPGPICQLMWSPASHPEKTLLIICENGYILESLCPTIKDVDDQNVITFAIPNVFLRCFHFTSVKSKILRFLEVQRREQQKMLKEKEKLERRMKLAEEREAFGEEEIPEEETSEEGEEEEPPLPEIFMPPTPSPILCGFYSEPGKFWVSLGNYDAGFLYHCQFPSYLHNSDFQKQENEPFDFRVLENTEDNPIRNITFSNDQTMMFCGMTNGAIRVYVLSENDPFLVSLQHYWHFNVHDNNYGSIKSITSSFDDQYLLTAGEDGNIFVFDIFSEFIVPKGIKAKVPSPRFGIESEAAPEDIEDPKAYSIENARKKREHDKLMKKVEELKAHKREQIKILRNEFWKLLELNKELPAHMQFQRTDFNIDAKIHAEIHKKTSLKIEQVEKELAWEKQKHELGLKKLQDRFREPLESDTIVVYATQSDHQIASYRLVKPSKYSKLKRPSQSERRQSKMERLEKEGPGKKESQRDTGGSISLQEESVLEKGKKFRPRTLSEIMVENQIEKTKKLIQQAERAQFKILQRKKEWEELYKSKPDDDYEDPKDVQAIKEAQTYMGDFNLKTAPDYKIPEHMRINAAKKEEELGYLDTMAHGKKRYMNKCILSLRDLKLAVIEEIQCLVQELKNIQSSIPASKHMPIPQVPQIYPEEVPERRFQYDEETLLRFQRKQKKRQDKSSSKQSGTGSGGSAGGGLVGFLKLSSGKEGDLTTRDSLSRSSKASALLELPKPVEFEKAEPSDAELEIMKRDEVKHLYMQQFLCNRINELTVTFDAELHLLRHQKLKLDTKMKLSDLHHLTLFQEMLLLKNFEKQENILQERVNSLDKEEQDMQWKINETLKEMEEKKNEITKLQDQEKALYAGFQAALGENNKFANFLMKVLKKKIKRAKKKEVEGDADEDEESEESSEEESSLESDEDASGSEDDVFDDSICPTNCDVSLFELALQLREKRLDIEEALVEEKKIVDNLKKEYDTISKKVKVVATNLNAAEEALEAYQREKQQRLNELLVVIPLKLHQIEYMEFGEVPEDLSGTLVFSNHSLDRLQERIVQLQEENAKQQKLNKECRERRKLLIREKREMAKTISKMEETVRELMISKFGRVIDLEALQTLSVNTTLEELKIKKLRKELSNAKELRMWEEKIAQVRWDLMMKTKEHTKKLHQMNDLCLEKKKLDSRLNTLQNQQGNAFQGLRKADIVAKQKVTELVQTQLEKITALKEEIELLRKKGGLLLPPITPKPKNEMKPMDT

Entity 12 Entity 12 polymer

Description description	Dynein, axonemal, heavy chain 6
Molecular weight formula_weight	475368.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MAFQGTEDEIDLKSIEHQAEENPILARLNKIKAKGILNYVSLKENEPEPPTLVFRHTTKAQERTRKRQQPVKLEPLPVLKVYQDHKQPEYIYEQNRQKLMSSGILKPSPSTADRASIISLEAQEAVKRKQVHRPSADVFSPSPTKLPRTSIGRRGLFGMRSSTYPTYTFHDREEVIKANIRDPLQIIKIVHENEHLGFLYMISAVPKSSIEYDTYNLKVVSYENINKNDYYTISKDAVTHVYNDDIEYIEIERWEQEYLYHRELTKIPIFALFRKWKAFSVWRKNVRSKKITGCRKALRKNLFIVNPYLRPALLKINEMCYLLSFMGLCYIEKFHTYTLQEFKAAQIVRLQEVTERLEVFRCAAKDVVRKSCRFALRAAGFIPDDCEVETYEDYFKANIASLVDGPFDLPTYGESEKMTYTEQASKRHHCMRLTCFIRLNDYLIQNTLHVLTVNTASSLLNFFSDKLKRTPSADVIQKWITEEKPEVTEKKGAPLMEKQEEDESLVPMFLTELILTVQSLLFEPSLEDFLDGISGAINHFENTVLSVPNLVPDSYFDAFTSPFINKKVEEKTCGPGPNLSAVFEDDRNFLTIIMQIKETIHAAFDSARLYAATFEKFQLFFKENESLDLEALKQEEPDVQFFSSQLEKYHKQHKDSVALRPTRNVGLLLIDTKQLKEKLIPSPLRCLEVLNSMLPCLSKKKVDAIISEAQDAEYKLEFMPTTTIEYVNSLVFLDEIQERIETLEEEANVVVQMYKLIEQYQVPTPPEDFAVFATMKPSITAVRNAIDKSVGDRETSIKQFCLHLGRDLEDLNNEVNEVKLLAQDPQILDISADQEKIKTMLSDLQSVLDDLQKRAFQYKSYQKNFKVEVSKFDALEEVSAELRLKQLLWDSLSEWDNLQQEWLKSKFDCLDPEVLNSQVTKYAKFVTQLEKGLPPNSVVPQLKQKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDALLVDTEIPLTLERLSELHVFNFAQEIQDISGQASGEAALEIILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINIATIASSRYVGPLKSRVDDWQKQLSLFNQTLEEWLNCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPTEGKIPGMDTEPEKVFTNDILAMLSPEGERVGLGKGLKARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKPRTEWVIAGHPSQVILTISQIMWCRDLTESLECEGDNVDALEDFEQVNFERLNALAAIVRGNLPKLHRNIITALITIDVHARDIVSELVQAKVDSADSFDWQRQLRYYWDMDLDNCVARMALSQYTYAYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDLSEDVVLIRALRDSNLPKFLTDDALLFSGIISDLFPGVQIPEHDYGILQSTIVEVMINQNLQPELCMVKKVIQLYETMLVRHGVMLVGPTGGGKTTVYQVLAETLGNLEKLNTDNPFYQPVKTYVLNPKSITMGELYGEVNNVTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMRTMSKKLNDEVQEYLLNLFNRYVDDGLHFVNKKCTQAIPQVDISKVTTLCCLLESLLLSKDGNILSMEQMKLNTVLCQTFVFCYLWSLGGNLTENYWDSFDTFIRTQFDDNPDARLPSSGDLWSIHIDFDTKRLDPWERIIPTFKYSRDVPFFEMLVPTTDTVRYGYLMEKLLAVRHSVLFTGTTGVGKSVIAKGLLNRIQESAGYVPVYLNFSAQTSSSRTQEIIESKLERKRKNILGAPGNKQVVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIVSACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILNGFLADFPEAVKQTSSNIVEAAVEIYNRMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREELQIFRLFCHECQRVFHDRLINNEDKHYFHLILTEMANKHFGIAIDLEYFLSKPIIFGDFIKFGAEKSDRIYDDLPDMEKIENVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCMQIELSRGYNYDNFHEDLRKLYKMAGVEDKDMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEKDELEHVLAATRPKAKEVGISEGNRDEVFQYFISRVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKSFFSSVDTGNDDLREKLSLMCVNVHLSVSHMAERYYNELRRRYYTTPTSYLELINLYLTMLTEKRKQLVSARDRVKNGLTKLLETNVLVDKMKLDLSALEPVLLQKSQDVEALMEKLVVDQESADQVRNVVQEDEAIAKVKAEETQAIADDAQRDLEEALPALEAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPDWPTAKQLLGDSNFLRRLLEYDKENIKPQILLKLQKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKEVEPKRQKLRAAQAELDATMATLKEKQALLKQVEDQIKTLQDKYEKGVNEKESLAKNMALTKARLIRAGKLTAALGDEQVRWEESIEKFQEELANIVGNVFIAAACVAYYGAFTAQYRQLLIEWWIESCLALEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKVIKLTDTNFLRILENSIRLGLPVLLEELREVLDPALEPILLKQTFMSGGRLLIHLGDSDIDYDKSFRFYMTSKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRIQLIVRINSDKNQLKSIEDKILKLLFTSEGNILDNEELIDTLQDSKITSGAIKTRLKEAESTELMINIARERYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSEKSDNLHERLKILLQQTLLTAYTNVSRGLFEQHKLIYSFMLCVDIMREHEQLTEAEWNFFLRGSAGMEKERPPKPEAPWLPIQMWFSCCDLEESFPIFEGLTKHILLRPISIKLGSFETYINPPVWEGYPKQRHEEEKDHVWGLDFSSFHKLILVKCCKEEKVVFALTDFVIENLGKQFIETPPVDLATLYQDMSNSTPLVFILSTGSDPMGAFQRFARESGYAERVQSISLGQGQGPIAEKMIKDAMKTGNWVFLQNCHLAVSWMLAMEELIKTFTDPNQTIKDTFRLFLSSMPCSTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPSFFEENILGMKWRKLIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLNLYCHEGKIPWDALIYITGEITYGGRVTDTWDQRCLRTVLKRFFSPETLDDDYTYSDSGIYFAPLADSLQDFKEYIEDLPLIDDPEIFGMHENANLVFQYKETNTLITTILEVQPRSSSGGQGKSNDEIVQELVASIQTRVPESLQMEGASESLFVKDPQGRLNSLTTVLGQEVDRFNNLLKLIHISLETLNKAIAGLVVMSEEMEKVYQSFLNNQVPSLWSNTAYPSLKPLGSWVKDLILRTEFVDLWLKRGQPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYNMIPVYRDQAAVIESAKDIQFGTELPMDKELPSPEDGVLVHGMFMDASRWDDKDMVIEDALPGQMNPMLPVVHFEPKQNYEPVHTLYHSPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRISDYWISKGSALLCQLSE

Entity 13 Entity 13 polymer

Description description	MORN repeat-containing protein 5
Molecular weight formula_weight	20105.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MQYTGSQYFGEYINGRMEGSAEYILPTDTRYIGEMKDGMFHGEGTLFFPSGSRFDAIWKKGLVVKGKYTFNDGLQYEDKHWHYCDSYDRRFYTEICYGLKPSGISQLTNMDPPRRIPLGYYDCGDGFYNPTTRVIKDYRNRFLRNADDDEHEWIVRTCRKGWLPMPKQKS

Entity 14 Entity 14 polymer

Description description	Cilia- and flagella-associated protein 61
Molecular weight formula_weight	143458.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSILTSPRGKVEVVHCRRTESQDIFCIKNLVRKFTQKLFGRLNIIYLLEKANLAVTVCNDKEEIMAHSIFLDYPNWNVAKQDNWIPLFRELDKEIPCTPLNTLFMHFFVAVDEYATGCLKEIIRTVFKAVPELYFIFLIVPTYLSLGSTLITVFDQVGNIPCLNYNEDFAVHICHRHNHYPQLHIRKARVEDHDDLMPIFMHYDNTLKEIYGEYFLAELIEAQDKDHHAVVCEVEGKAVGFMSVCTSVNLPLLHECFDLGPFHGFCTPHPDDILKPSREPSLEEGEEKHLKKCSTSLIIREMQIKTTLRFHLTPVRMAKIKNSETETSASCEEALPTVLGLVSEERLKQDMEKNLSILSLVDEEDVASSLSSSLLLSVESSHFRPLYLGDPIAFCIQLFCIDERYEARQVLISNVSLSLDFMSFVFSLFPGKNFCLISVPHLTPEFVLIQNFVKVVPFNNCTLDHDLYVFHRAGLLRSITIRLAKFLDTAGVEKLVSTLLLSTKILDDLAQYNEAGRDPDGTALQVFVAEVADQIVGIAVIRKEMDIEYIRSHYNIEDFIYFSHHQQEEHGRLNHFALNPIFRHYTKFFLKEILRLGYKSCLYYPVYPQTREGKLQSSYSHSLTSALHYLVPVRPRRQIVYPLEKLGINAPSKEVSKDQVSFALNHTNRKLTLEPKVTVNARIVVVGASSVGISFLETLVFCSHLKFNNLTLISTHGLPGKRLLHNEQRKFLASDHCFNDKDYALMSLCSWVNVVVGRMTAIDRAAKQVVVSKSEIVFYDHLILCTGLQYQVPCPTGADTEQHLTNREVLELSKQRYTGTVPSNLFILNDEEDCVRMLCWLRNSSILTEGKVIVYGNTLDAYTTVETLLNIGMKGSGIYFVHPPTESNITCINNNDVESAVEDALSAAGVTVFHDALLAQWNHGQHPDPIYNACFTTSTKPIRLECSAFFSFYKKNVDYETFKAFNDACLVYDGRLVIDTTFHTNDIAIRAAGSLTKFSNRYYSNEWTHSNFSSKEIGFQLAAAMLSLFDPTLEPVTEPPADLDRLIPMYKGAKIQGGILPGSYHYLHISKPAIPTPLNLQRSQPDFGSDVVTGNAKKGTYFRLYINNYKLVEAITCFSKEPFPSSNYIRLFGQHEQVLNNLCTRFDDKLIPDLYSYFTEPWCMALFHDRFIDLKKELRQILISKQEEDKPTMEEIAYRLEEEEINLNEKPQKYLQRVFEDSIYKSLLEKSILDYLHYNQYHLPMYAWPGII

Entity 15 Entity 15 polymer

Description description	Cilia- and flagella-associated protein 251
Molecular weight formula_weight	148784.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MSDTEENPLEESRESGEMEEEKEEKKEEEEEEEEGEKEKEEEEEEEKGKEEEKEEEKEEGKEEEKKEEEEEKGKKEEEEEEEEEGKGKEEEKEEEKEEEEKEEEKEKEEEEEEEGKGKEEEEEGKEEEEEEKEEEEKEEEKEEEEEEEEEKEEYNPSFEEDALQQSLTEGSLSWEESQEDGEGLEEWVEKEEQREGEEVRGEEESEVRGREEEEGWEEEKSGEEEKSEESERSKERGGEEEGQEKEEAEHEGEREEGREEEEKEKSVEREEEEEEEDTETTETKAGRAKEEKKEKQNKTALVDNIVISHEPPRSSSSLADSPEVSQIYKDNSMKVDDTEEASQKPEDILAQGKDEARLSLEERRKLFQSKGLSAEESLVSVSTEDTLFQKEEDSKVYPLSMTWSFGWNSSLPVYYMREDRRVILYTCAHTAIMYDVVRNTQYHLQGHPNIISCLCVSEDRRWIATADEGPDCLIIIWDSFTGIPVHTIFDSCPEGNGMRSIAITRDSKFLATISDSATQKVCIWKWTLAVETPACTLELPKEYGFQDNLVFNPANNKELVSNSKTQAIYYCWFEDKGILAHSAPVLTEKTFNKLVGKFSQSVFHLKLPQVLSATKEGKLVVWDIHYPSSTSSSAISAFPFIKPRKLVHLQKEAITVLMTIDSYIVTGDIKGNIKFYDHTLSVVNWYSNFKLGAIRTLSFSKTIPSLPTEKSNLPTDCTLRGDLFVVRNFIIGTFDATVYHMTVDGTKLEKLFVEPRDAVYAVSCHPYQPLIAVGSVCGMIKVWDFEKKVYLFSRTFEKGLGVQCLTYNPEGALLGAGFTEGTVYILDAMSLENESPEPFKYSKSSVSHCCFSHDSNYMATADVNFTVAVYMVVVKNGQRVWEYLARLRSHQNSIQSLLFGVHLDSNEPRLLSLGKDRFLIEYNLVKSCKDHLDVLDVHRTDQGNYPTCMIWYPPLTKELFLLICNSGYKVKLFNATTKMCRKTLLGPAYGSPIEHAQVLPVKSTLELQKRYLVFINKDKVGLQILPVDGNPHKTCAIVCHPNGVAGMALSYDGRFAFTAGGQDRSVVQWKINLGALEAAVSLGGEDLTPFYGLVSGGREGKFYRELEDYFYYSQIRSQGIDTMETRQVSEHICLSELPFVMRAIGFYPSEEKIEDMFNEIKFSEYVETGKLIDKINLPDFLKVYLNHRPPFGNTMDGIQNSFNVLGYTNSEGKKAIRREDFLNLLLTKGEHMTEEEMIDCFSTLFGLTPEGWKSEPAATCINGPEICLQKELPEEITAEIFTTEILGLTLSDSSEQLIQ

Entity 16 Entity 16 polymer

Description description	Tetratricopeptide repeat protein 29
Molecular weight formula_weight	54413.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MATFPPLPMTHTRLAILARQKLPCSSKKIPRAQLIKEKEDIDYYLEQNFKGLSKEEVAAHRNSYKKSICVDMLRDGFHKSFTELFALMEQWDKLREAAKAQSLFWQQRPLEDQPDKLDNFYHYLTRAEAAERKGYYEEVYNNLYALACYFDNSEDKWVRNHFYERCFNIAQLIKADGGKKEAEAESHMGLLFEEEGELLKAAEHYEAFHELTHGRLWKDGTGQLLNLVACESLVRTYRLLSDRMLENKDYKQAIKILIKASEIAREGNDRSMEGEASYYLGLAHLASGEYETALTVLNRYSEISTSLDDDHGLGRAYEAIAKALQSQGETTEAINYLEKFVTIARNNLQSLDMIRACTMLGDIYNEKGQYSKASEYFQQAFSTAMELMKTALMDETKVHYGIARAHQMMLAMKGYIESADSNGLNCLLSWKETRTQIEYDPILGESRRATEDNIYQLPDAEEETRRSPENQ

Entity 17 Entity 17 polymer

Description description	Zinc finger, MYND domain containing 12
Molecular weight formula_weight	41394.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MNVIYPLAVPKGRRLSCEVCEAPAERMCTACTVTYYCGPVHQKADWDSIHAKICQLLIPLRTTMPFYNSEEERQHGLQQLQRRQKHLIEFCYTVAQKYLFEGRHEDAVPAALHSLRFRMNVHGLSSVELVPAYLLLAEASLGLGRIVQAEEYLSQAQWTVLKSTDCSNATHSLLHRNLGLLYIAKKNLDEARYHLANDIYFASCAYGTEDIRTSGGYFHLANIFYGLKKMELADTLYTKVSEIWYTYLNSHYQALLEARSQQTDLLGKQFVNDTGLDEAQEAEAIRILTSTLIIQESTSTKAPQKSILILKTLSILYYLMLECSKAKEYAMKALSLAETYVSEEEQRFIQELLSVISAEEKQP

Entity 18 Entity 18 polymer

Description description	Malate dehydrogenase, cytoplasmic
Molecular weight formula_weight	36555.1 kDa
EC 编号 ec_number	1.1.1.37,1.1.1.96
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIATDKEEIAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGTALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAIADHIRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKETAFEFLSSA

Entity 19 Entity 19 polymer

Description description	Putative malate dehydrogenase 1B
Molecular weight formula_weight	56356.2 kDa
EC 编号 ec_number	1.1.1.-
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MAKFVIAGKANCPYYAKAELLADYLQKNLPDFRIFKITQHPDKWEDWVEDVCERNMWDHRTSPIIWRELLDRGGRGLLLGGYNEFLEHAQLYYGVTSNMTTELMMVIAKENMQTHTEQQLDKETMKDLISPLQVWIASAGTYVCCHLIPLLLSGEVFGMHTEISLTLFDQEQREDCLRSIVMETQDLASPVLRTVSFCTTVKEAFLQAQVIIILDDSTEEEVYSLESCLRSRVPLCRLYGYLIEKNAHKSVKVIVGGKNFVNLKTTLLMQYAPNIASNIIAVALGVEGQAKAVLARKMKTTSANIKDVIIWGNITGNNYVDLRKAKVYNYESAVKGPPGHYHSVLSLIFDREWITKEFVQTLKILSSTGKQFGGILAAHSIATTLKYWYHGSPPGEIVSLGVMSEGQFDIPEGIVFSMPVKFENGTWVVLTDLEDISLSEKTLSRLTGDLIQEKLVACGDLLTFQPIEEDPKDNEPSNTGMNEEKEQPGSDDSDEKNEDQ

Entity 20 Entity 20 polymer

Description description	UPF0728 protein C10orf53 homolog
Molecular weight formula_weight	10393.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MPAQAVVTLRYGPYSAVGLSVEHRTYRLQGLQAVLAKDGHQIILEQIEDWNLVELVVNEETVFQCDIQELEFGGDGKLDPLCEEARIAVLNAF

Entity 21 Entity 21 polymer

Description description	A kinase (PRKA) anchor protein 14
Molecular weight formula_weight	58332.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a

MSNKKKFPNQKAKIVENTSTAKTKKPEAPEPKHVTEPKDSKSVEDPKIPVTDQKEKKTVTTIAEPKDKKSETEPKEKKTVTISDPKAKKPAIEKDKRTVTFVTEVKDKRIVTDTKENRIASIDTKEKVPVVVPEVKEKRVQLLDPKEKVAVLPTTPIGSVAHVPHAPPVAHTEHAAPAKPVAPAKPVAPVAPAKPVAPVAPAKPVVPVAPAKPVAPAAPVTSVVRAVPAAPVTPVAPVAPAVPVVPAAPVAPAAPVVPAAPVAPVAPALPVAPVAPVAPALPVAPAVPVAPAVPVAPVVPEVKQKIPVSEVKGKKEVPLRVPELKEIKASSFAPEIKVKKVGSEIKQKAHVKDVKEKKIVPEVKEKKPVVVKKKDGASEVARTVVDGVMAAAVEMVEEARNPIKNIKWLTHGEFTPEKGRKQIEKFVSTWEFQNRWVYYADFIEKKDLIHSYHYIYRVRWSAPTAVRPMARVSANALFTIKFNKSKPADMPVDVSYIFENSELLQRPGEIRFREQWLRDITETKHILLESIPFKVV

Entity 22 Entity 22 polymer

Description description	cAMP-dependent protein kinase type II-alpha regulatory subunit
Molecular weight formula_weight	45443.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MSHIQIPPGLTELLQGYTVEVGQQPPDLVDFAVEYFTRLREARRQESDTFIVSPTTFHTQESSAVPVIEEDGESDSDSEDADLEVPVPSKFTRRVSVCAETFNPDEEEEDNDPRVVHPKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFEKIVKTDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIIATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLFKSLEMSERMKIVDVIGEKIYKDGERIIAQGEKADSFYIIESGEVSILIRSKTKSNKNGGNQEVEIAHCHKGQYFGELALVTNKPRAASAYGVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSNLDLMDPGQ

Entity 23 Entity 23 polymer

Description description	Ciliogenesis-associated TTC17-interacting protein
Molecular weight formula_weight	59355.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c

MGDVTRGEWVVWGLEAGPGETASLHHPGLEDMLLFFPETLAILSDTGEPQGELTIEVQRGKYKDDIGILTHCLLVHASSRGFLDKSLCGSSLLGYLNNNLELMEQHSQEFIKFPVLPMERKMSVLKQDGQFVVTRSVKEGEETKTGVSVFPYKTFKGFVSSAANVVLLRVMAWQQSVPSGARFLALDSEGKLCHCTYKSLGFQTIQVGNQQAKMFIVEQTIHSEEGIPFSCQYYLLPDGHLAKRVQVGSPGCCIITKMPLIREEDVIESPPTFDKKPLVWGEDLELYSKFLDRKEQLRLSHASYLRHHPEAQALVSDFLLFLLLRRPEDVVTFAAEHFRPFAALRSPIPALRSSHQPSPFRTLENEEEEEAKEEEEKEEEEEEEEEIAGEIEGEEEEEEIEEGDDYLYMDEDEDIEDYTYYENYYYNYDEEVDSYDDVNNYDDDDIANVDDNDDIDNYDDDNDDDDDDDDNDDEDDVDDNDDDDVDKVRAKVDNLSVDNDDNDVVNSDNVDVDNDNNNQG

Entity 24 Entity 24 polymer

Description description	Adenylate kinase 7
Molecular weight formula_weight	82643.6 kDa
EC 编号 ec_number	2.7.4.3
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,G

MAEEEVPATTEKVLKIQRVFINHLDTYSSGNIGKFLANCVAGASLEEIGEEEEEEDETKSAVAPEAPTTKVKEGTFQIVGTLVKPESVKPDFAVEAYKGISREDLLSHLMECDAVIYNITENVQQVEEALWAVSALNEEISHFEKRKVFILLSTVMTWARSKPLDPDDNEVPFTEEDYRRRKHHPNFLDHINAEKIVLKFGKNAKKFATYVVASGLQYGAEGGILHTFFKMAWLGEVPALPVFGDGTNCIPAIHVVDLAGVIQNIIDHVPKLHYLVAVDEAVHTLEDLVKCISKNTGPGKIQKVPKENAFLTKDLTQEYLDHLLVNLRMEALFVKENFNIRWVAQTGFVENINSILKEYKQSRGLLPIKICILGPPAVGKSSISEELAKYYKLHHIKMKDVIAEAIAKLEAIVAPKDSVEGEEEGEEEEEEENVDDAQELLDGIKESMEQNAGRLEDQYIIRFVKEKLKSMPCRNQGFILDGFPKTYDQAKDLFNQEEEEEEEEIRGKIFPYDKLITPEFVCGLDASDEFLKERVMNLPESVVAGTHYSQDRFLRSLSHYRDINTDDETVFNYFDELEIHPIHIDVGKLEDAQNRLAIKQLIKEIGKPRNYGLTDEEKAEEEKKAAEERLAKEAAQTAELEHKEAMEMAEKIARWEEWNKRLEEVKREERELLEVQSVPLRNYLMTYVMPTLMQGLNECCKVRPEDPVDFLAEYLFKNNPEMQ

Entity 25 Entity 25 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	4.70 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	63152

fit	/app/data/saxs_computation/d2/9d2f/9d2f.fit
pddf	/app/data/pr_computation/d2/9d2f/9d2f.pr.out
profile	/app/data/saxs_computation/d2/9d2f/9d2f.dat