9h0m

Structure of avian Pit54 SRCR 1-2 in complex with hemoglobin

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hemoglobin subunit alpha-A

OrganismNot specified

UniProt P01994

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 6 其他Polymer 2	Hemoglobin subunit beta × 2 （P02112） PIT54 protein × 2 （A0A8V0XEL0） ;beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 4	Consistent with protein count
2	Other combination	Heteromer	Protein 6 其他Polymer 1	Hemoglobin subunit beta × 2 （P02112） PIT54 protein × 2 （A0A8V0XEL0） alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HBA_CHICK
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–142； UniProt 1–142 Author chain C； PDBConstruct 1–142； UniProt 1–142 Author chain G； PDBConstruct 1–142； UniProt 1–142 Author chain I； PDBConstruct 1–142； UniProt 1–142

Hemoglobin subunit beta

OrganismNot specified

UniProt P02112

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 6 其他Polymer 2	Hemoglobin subunit alpha-A × 2 （P01994） PIT54 protein × 2 （A0A8V0XEL0） ;beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 4	Consistent with protein count
2	Other combination	Heteromer	Protein 6 其他Polymer 1	Hemoglobin subunit alpha-A × 2 （P01994） PIT54 protein × 2 （A0A8V0XEL0） alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HBB_CHICK
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–147； UniProt 1–147 Author chain D； PDBConstruct 1–147； UniProt 1–147 Author chain H； PDBConstruct 1–147； UniProt 1–147 Author chain J； PDBConstruct 1–147； UniProt 1–147

PIT54 protein

Gallus gallus

UniProt A0A8V0XEL0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 6 其他Polymer 2	Hemoglobin subunit alpha-A × 2 （P01994） Hemoglobin subunit beta × 2 （P02112） ;beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ; × 2 PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 4	Consistent with protein count
2	Other combination	Heteromer	Protein 6 其他Polymer 1	Hemoglobin subunit alpha-A × 2 （P01994） Hemoglobin subunit beta × 2 （P02112） alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose × 1 PROTOPORPHYRIN IX CONTAINING FE × 4 CALCIUM ION × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A8V0XEL0_CHICK
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain E； PDBConstruct 1–508； UniProt 1–508 Author chain F； PDBConstruct 1–508； UniProt 1–508 Author chain K； PDBConstruct 1–508； UniProt 1–508 Author chain L； PDBConstruct 1–508； UniProt 1–508

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9h0m
Deposition date deposition_date	2024-10-08
Last revision last_revision	2025-10-29
Structure title title	Structure of avian Pit54 SRCR 1-2 in complex with hemoglobin
Keywords keywords	Acute phase protein, Hemoglobin scavenging, TRANSPORT PROTEIN; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9h0m__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9h0m__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9h0m__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	33.91 Å
Rg (electron density)	32.80 Å
Total Rg	33.51 Å
Atom count	7816
Residues	996
Excluded volume	138610 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9h0m__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9h0m__assembly_2__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	Hemoglobin subunit alpha-A
Molecular weight formula_weight	15453.9 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,G,I
Atom count atom_count	15794

MVLSAADKNNVKGIFTKIAGHAEEYGAETLERMFTTYPPTKTYFPHFDLSHGSAQIKGHGKKVVAALIEAANHIDDIAGTLSKLSDLHAHKLRVDPVNFKLLGQCFLVVVAIHHPAALTPEVHASLDKFLCAVGTVLTAKYR

Entity 2 Entity 2 polymer

Description description	Hemoglobin subunit beta
Molecular weight formula_weight	16489.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,H,J

MVHWTAEEKQLITGLWGKVNVAECGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKKVLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPECQAAWQKLVRVVAHALARKYH

Entity 3 Entity 3 polymer

Description description	PIT54 protein
Molecular weight formula_weight	54905.1 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,K,L

MKGGFRIEGRSQGCGDFSNTMPLGCMSCFLPAVFSVTNMRFILLPCLWASLAGVLLAEDVDTSTAEVRLVDGPNRCSGRVEVLHNDVWGTVCDEGWDLREARVVCRQLGCGTALSSPKKSKYGEGKGQIWLSDLDCKGTEGSLSNCKSKPWGENICNHVEDASVECSGTEIPEPGPLRLVGGPNRCAGRVEVLHEEQWGSVCHDEWDINDAQVVCKQLGCGDAVLAPIAAKFGRGTDTIWLDDVNCTGSEASLSECQARPWGDHNCYHGEDASAICSDSGISISTSVRLVGGPNRCSGRVEVLHNNVWGTVCDDNWDLREAKVVCKQLGCGTALSALPESKYGEGKGQIWLSDLNCTGTEGSLTECEAKPWGENVCNHVEDASVECSETDISEIGPVRLVDGPNQCAGRVEVFHENRWGSVCDDNWDMKDAKVVCKQVGCGSPLSALGSARYGRGPDVIWLDDVNCEGTEESIFDCKARPWGEHNCYHGEDASVFCTVNKNLEETETS

Source Source

Source organism organism	Gallus gallus
Common name common_name	chicken
NCBI taxonomy ID ncbi_taxonomy_id	9031
Host organism host_organism	Cricetulus griseus

Entity 4 Entity 4 branched

Description description	;beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	732.7 kDa
Source method src_method	man
Copy count entity_count	2

Entity 5 Entity 5 branched

Description description	alpha-L-fucopyranose-(1-6)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	367.3 kDa
Source method src_method	man
Copy count entity_count	1

Entity 6 Entity 6 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 7 Entity 7 non-polymer

Description description	CALCIUM ION
Molecular weight formula_weight	40.1 kDa
Source method src_method	syn
Copy count entity_count	8

▶

Unit-cell length a length_a	101.534 Å
Unit-cell length b length_b	157.592 Å
Unit-cell length c length_c	175.689 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	orthorhombic

Resolution resolution	2.640 Å
Low-resolution limit resolution_low	58.680 Å
R factor r_factor	0.2026
R_work r_work	0.2014
R_free r_free	0.2380

Structure of avian Pit54 SRCR 1-2 in complex with hemoglobin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hemoglobin subunit alpha-A

State in the Current Structure

Other States of the Same Protein in the Database

Hemoglobin subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

PIT54 protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9h0m__assembly_2__model_1

9h0m__assembly_2__model_1 | I(q)

9h0m__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 branched

Entity 5 Entity 5 branched

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

7. Citations (1)

Structure of avian Pit54 SRCR 1-2 in complex with hemoglobin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Hemoglobin subunit alpha-A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Hemoglobin subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

PIT54 protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9h0m__assembly_2__model_1

9h0m__assembly_2__model_1 | I(q)

9h0m__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 branched

Entity 5 Entity 5 branched

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

7. Citations (1)