SAXSdb — 9hjk

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cationic amino acid transporter 4, vacuolar

Arabidopsis thaliana

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	SybB5 × 1 CHOLESTEROL × 1 Lauryl Maltose Neopentyl Glycol × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CAAT4_ARATH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–562； UniProt 21–582

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9hjk
Deposition date deposition_date	2024-11-29
Structure title title	Cryo-EM structure of the Arabidopsis thaliana CAT4 transporter in the outward-open apo state
Keywords keywords	cationic amino acid transporter, APC fold, LeuT fold, cholesterol, outward-open state, cationic amino acids, SLC7, MEMBRANE PROTEIN; MEMBRANE PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9hjk__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9hjk__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9hjk__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	28.49 Å
Rg (electron density)	27.41 Å
Total Rg	28.10 Å
Atom count	4817
Residues	631
Excluded volume	87941 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9hjk__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Cationic amino acid transporter 4, vacuolar
Molecular weight formula_weight	59390.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	4818

PHQLAKKLSAVDLVAIGVGTTIGAGVYILVGTVAREHTGPALAVSFFIAGVAAALSACCYAELASRCPSAGSAYHYAYICLGEGIAWLVGWALVLDYTIGGSAIARGITPNLASFFGGLDNLPVFLARQTIPGVGIVVDPCAALLIMIVTILLCFGIKESSTVQAIVTSVNVCTLVFIIVVGGYLACKTGWVGYDLPSGYFPFGLNGILAGSAVVFFSYIGFDTVTSTAEEVKNPQRDLPLGIGIALLICCILYMLLSVVIVGLVPYYSLNPDTPISSAFGDSGMQWAAYILTTGAITALCASLLGSLLAQPRIFMAMARDGLLPAFFSEISPRTQVPVKSTIAIGVLAAALAFFMDVAQLSEMVSVGTLMAFTAVAVCVLVLRYVPPDGVPLSSSSQTLSDTDESRAETENFLVDAIESSDSPLLGNETARDEKYFGKRRKIAAWSIALVCIGVLGLASAASAERLPSFPRFTICGVSAVILLGSLITLGYIDEDEERHNFGHKGGFLCPFVPYLPVLCILINTYLIINIGAGTWIRVLIWLLIGSMIYIFYGRSHSLLNN

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Saccharomyces cerevisiae

Entity 2 Entity 2 polymer

Description description	SybB5
Molecular weight formula_weight	12826.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GSSSQVQLVESGGGLVQAGGSLRLSCAASGFPVNMYWMHWYRQAPGKEREWVAAIQSYGQWTAYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAVGVGGYYLGQGTQVTVS

Source Source

Source organism organism	synthetic construct
NCBI taxonomy ID ncbi_taxonomy_id	32360
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	CHOLESTEROL
Molecular weight formula_weight	386.7 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	Lauryl Maltose Neopentyl Glycol
Molecular weight formula_weight	1005.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.27 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	642325

Cryo-EM structure of the Arabidopsis thaliana CAT4 transporter in the outward-open apo state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cationic amino acid transporter 4, vacuolar

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9hjk__assembly_1__model_1

9hjk__assembly_1__model_1 | I(q)

9hjk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (2)

Cryo-EM structure of the Arabidopsis thaliana CAT4 transporter in the outward-open apo state

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cationic amino acid transporter 4, vacuolar

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9hjk__assembly_1__model_1

9hjk__assembly_1__model_1 | I(q)

9hjk__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (2)