9is6

CryoEM structure of Plant-Complex-C-5b

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

COP9 signalosome complex subunit 1

Arabidopsis thaliana

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	COP9 signalosome complex subunit 8 × 1 （P43255） COP9 signalosome complex subunit 7 × 1 （Q94JU3） COP9 signalosome complex subunit 6b × 1 （Q8W1P0） COP9 signalosome complex subunit 5b × 1 （Q9FVU9） COP9 signalosome complex subunit 3 × 1 （Q8W575） COP9 signalosome complex subunit 4 × 1 （Q8L5U0） COP9 signalosome complex subunit 2 × 1 （Q8W207） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN1_ARATH
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–441； UniProt 1–441

COP9 signalosome complex subunit 8

Arabidopsis thaliana

UniProt P43255

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	COP9 signalosome complex subunit 1 × 1 （P45432） COP9 signalosome complex subunit 7 × 1 （Q94JU3） COP9 signalosome complex subunit 6b × 1 （Q8W1P0） COP9 signalosome complex subunit 5b × 1 （Q9FVU9） COP9 signalosome complex subunit 3 × 1 （Q8W575） COP9 signalosome complex subunit 4 × 1 （Q8L5U0） COP9 signalosome complex subunit 2 × 1 （Q8W207） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN8_ARATH
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain H； PDBConstruct 1–197； UniProt 1–197

COP9 signalosome complex subunit 7

Arabidopsis thaliana

UniProt Q94JU3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	COP9 signalosome complex subunit 1 × 1 （P45432） COP9 signalosome complex subunit 8 × 1 （P43255） COP9 signalosome complex subunit 6b × 1 （Q8W1P0） COP9 signalosome complex subunit 5b × 1 （Q9FVU9） COP9 signalosome complex subunit 3 × 1 （Q8W575） COP9 signalosome complex subunit 4 × 1 （Q8L5U0） COP9 signalosome complex subunit 2 × 1 （Q8W207） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN7_ARATH
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–260； UniProt 1–260

COP9 signalosome complex subunit 6b

Arabidopsis thaliana

UniProt Q8W1P0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	COP9 signalosome complex subunit 1 × 1 （P45432） COP9 signalosome complex subunit 8 × 1 （P43255） COP9 signalosome complex subunit 7 × 1 （Q94JU3） COP9 signalosome complex subunit 5b × 1 （Q9FVU9） COP9 signalosome complex subunit 3 × 1 （Q8W575） COP9 signalosome complex subunit 4 × 1 （Q8L5U0） COP9 signalosome complex subunit 2 × 1 （Q8W207） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN6B_ARATH
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain F； PDBConstruct 1–317； UniProt 1–317

COP9 signalosome complex subunit 5b

Arabidopsis thaliana

UniProt Q9FVU9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	COP9 signalosome complex subunit 1 × 1 （P45432） COP9 signalosome complex subunit 8 × 1 （P43255） COP9 signalosome complex subunit 7 × 1 （Q94JU3） COP9 signalosome complex subunit 6b × 1 （Q8W1P0） COP9 signalosome complex subunit 3 × 1 （Q8W575） COP9 signalosome complex subunit 4 × 1 （Q8L5U0） COP9 signalosome complex subunit 2 × 1 （Q8W207） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN5B_ARATH
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–358； UniProt 1–358

COP9 signalosome complex subunit 3

Arabidopsis thaliana

UniProt Q8W575

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	COP9 signalosome complex subunit 1 × 1 （P45432） COP9 signalosome complex subunit 8 × 1 （P43255） COP9 signalosome complex subunit 7 × 1 （Q94JU3） COP9 signalosome complex subunit 6b × 1 （Q8W1P0） COP9 signalosome complex subunit 5b × 1 （Q9FVU9） COP9 signalosome complex subunit 4 × 1 （Q8L5U0） COP9 signalosome complex subunit 2 × 1 （Q8W207） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN3_ARATH
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain C； PDBConstruct 1–429； UniProt 1–429

COP9 signalosome complex subunit 4

Arabidopsis thaliana

UniProt Q8L5U0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	COP9 signalosome complex subunit 1 × 1 （P45432） COP9 signalosome complex subunit 8 × 1 （P43255） COP9 signalosome complex subunit 7 × 1 （Q94JU3） COP9 signalosome complex subunit 6b × 1 （Q8W1P0） COP9 signalosome complex subunit 5b × 1 （Q9FVU9） COP9 signalosome complex subunit 3 × 1 （Q8W575） COP9 signalosome complex subunit 2 × 1 （Q8W207） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN4_ARATH
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain D； PDBConstruct 1–397； UniProt 1–397

COP9 signalosome complex subunit 2

Arabidopsis thaliana

UniProt Q8W207

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 8	COP9 signalosome complex subunit 1 × 1 （P45432） COP9 signalosome complex subunit 8 × 1 （P43255） COP9 signalosome complex subunit 7 × 1 （Q94JU3） COP9 signalosome complex subunit 6b × 1 （Q8W1P0） COP9 signalosome complex subunit 5b × 1 （Q9FVU9） COP9 signalosome complex subunit 3 × 1 （Q8W575） COP9 signalosome complex subunit 4 × 1 （Q8L5U0） ZINC ION × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CSN2_ARATH
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain B； PDBConstruct 1–439； UniProt 1–439

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9is6
Deposition date deposition_date	2024-07-17
Structure title title	CryoEM structure of Plant-Complex-C-5b
Keywords keywords	complex, PLANT PROTEIN; PLANT PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9is6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9is6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9is6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	45.57 Å
Rg (electron density)	44.85 Å
Total Rg	44.84 Å
Atom count	14912
Residues	1987
Excluded volume	264190 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9is6__assembly_1__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Description description	COP9 signalosome complex subunit 1
Molecular weight formula_weight	50650.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	14912

MERDEEASGPMMEMCTNGGEETSNRRPIISGEPLDIEAYAALYKGRTKIMRLLFIANHCGGNHALQFDALRMAYDEIKKGENTQLFREVVNKIGNRLGEKYGMDLAWCEAVDRRAEQKKVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFKNYIRTRDYCTTTKHIIHMCMNAILVSIEMGQFTHVTSYVNKAEQNPETLEPMVNAKLRCASGLAHLELKKYKLAARKFLDVNPELGNSYNEVIAPQDIATYGGLCALASFDRSELKQKVIDNINFRNFLELVPDVRELINDFYSSRYASCLEYLASLKSNLLLDIHLHDHVDTLYDQIRKKALIQYTLPFVSVDLSRMADAFKTSVSGLEKELEALITDNQIQARIDSHNKILYARHADQRNATFQKVLQMGNEFDRDVRAMLLRANLLKHEYHARSARKL

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	COP9 signalosome complex subunit 8
Molecular weight formula_weight	22573.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MDLSPVKEALAAKSFDKIADICDTLMLQVASEGIEYHDDWPYAIHLLGYFYVDDCDSARFLWKRIPTAIKERKPEVVAAWGIGQKLWTHDYAGVYEAIRGYDWSQEAKDMVAAFSDLYTKRMFQLLLSAYSTITIHDLALFLGMTEDDATTYVVENGWTVDAASQMASVKKQAVKREQKVDSSKLQRLTEYVFHLEH

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	COP9 signalosome complex subunit 7
Molecular weight formula_weight	29508.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MDIEQKQAEIIDQLVKRASTCKSEALGPLIIEATSHPSLFAFSEILALPNVAQLEGTTDSVYLDLLRLFAHGTWGDYKCNATRLPHLSPDQILKLKQLTVLTLAESNKVLPYDTLMVELDVSNVRELEDFLINECMYAGIVRGKLDQLKRCFEVPFAAGRDLRPGQLGNMLHTLSNWLNTSENLLISIQDKIKWADNMSEMDKKHRKEAEEGVEEVKKSLSMKGDVDIRGNKEMFGEPSGVMDYEEDGIRPKRRRHPVTR

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	COP9 signalosome complex subunit 6b
Molecular weight formula_weight	35446.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MAPSSSSGLTFKLHPLVMLNISDHFTRVKTQLNPPAASCATGNGSNNADAMLLQNPRVYGCVIGLQRGRTVEIFNSFELIFDPALDTLDRSFLEKKQELYKKVFPDFYVLGWYSTGSDATESDMHIHKALMDINESPVYVLLNPAINHAQKDLPVTIYESEFHVIDGIPQSIFVHTSYTIETVEAERISVDHVAHLKPSDGGSAATQLAAHLTGIHSAIKMLNSRIRVLYQHIVAMQKGDKPCENSVLRQVSSLLRSLPAAESEKFNENFLMEYNDKLLMSYLAMITNCTSNMNEVVDKFNTAYDKHSRRGGRTAFM

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 polymer

Description description	COP9 signalosome complex subunit 5b
Molecular weight formula_weight	40362.0 kDa
EC 编号 ec_number	3.4.-.-
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MEGSSSTIARKTWELENSILTVDSPDSTSDNIFYYDDTSQTRFQQEKPWENDPHYFKRVKISALALLKMVVHARSGGTIEIMGLMQGKTDGDTIIVMDAFALPVEGTETRVNAQDDAYEYMVEYSQTNKLAGRLENVVGWYHSHPGYGCWLSGIDVSTQRLNQQHQEPFLAVVIDPTRTVSAGKVEIGAFRTYSKGYKPPDEPVSEYQTIPLNKIEDFGVHCKQYYSLDVTYFKSSLDSHLLDLLWNKYWVNTLSSSPLLGNGDYVAGQISDLAEKLEQAESHLVQSRFGGVVPSSLHKKKEDESQLTKITRDSAKITVEQVHGLMSQVIKDELFNSMRQSNNKSPTDSSDPDPMITY

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Trichoplusia ni

Entity 6 Entity 6 polymer

Description description	COP9 signalosome complex subunit 3
Molecular weight formula_weight	47792.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MIGAVNSVEAVITSIQGLSGSPEDLSALHDLLRGAQDSLRAEPGVNFSTLDQLDASKHSLGYLYFLEVLTCGPVSKEKAAYEIPIIARFINSCDAGQIRLASYKFVSLCKILKDHVIALGDPLRGVGPLLNAVQKLQVSSKRLTALHPDVLQLCLQAKSYKSGFSILSDDIVEIDQPRDFFLYSYYGGMICIGLKRFQKALELLYNVVTAPMHQVNAIALEAYKKYILVSLIHNGQFTNTLPKCASTAAQRSFKNYTGPYIELGNCYNDGKIGELEALVVARNAEFEEDKNLGLVKQAVSSLYKRNILRLTQKYLTLSLQDIANMVQLGNAKEAEMHVLQMIQDGQIHALINQKDGMVRFLEDPEQYKSSEMIEIMDSVIQRTIGLSKNLLAMDESLSCDPLYLGKVGRERQRYDFGDDFDTVPQKFSM

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Trichoplusia ni

Entity 7 Entity 7 polymer

Description description	COP9 signalosome complex subunit 4
Molecular weight formula_weight	45007.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MDEALTNASAIGDQRQKIEQYKLILSSVLSSNDLLQAQRFIDHILSDDVPLVVSRQLLQSFAQELGRLEPETQKEIAQFTLTQIQPRVVSFEEQALVIREKLAGLYESEQEWSKAAQMLSGIDLDSGMRAVDDNFKLSKCIQIARLYLEDDDAVNAEAFINKASFLVSNSQNEVLNLQYKVCYARILDMKRKFLEAALRYYGISQIEQRQIGDEEIDENALEQALSAAVTCTILAGAGPQRSRVLATLYKDERCSKLKIYPILQKVYLERILRRPEIDAFSEELRPHQKASLPDKSTVLDRAMIEHNLLSASKLYTNIRFDELGTLLAIDPRKAEKIAANMIGQDRMRGSIDQEEAVIHFEDDVEELQQWDQQISGLCQALNDILDGMAKKGMSVPV

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Trichoplusia ni

Entity 8 Entity 8 polymer

Description description	COP9 signalosome complex subunit 2
Molecular weight formula_weight	51254.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MASDADMEDYGFEYSDEEQEEQDVDIENQYYNSKGMVETEPEEALSGFAEVVQMEPEKADWGFKALKQTVKIYYRLGKYKEMMEAYTEMLTYIKSAVTRNYSEKCINNIMDFVSGSASQNTGLLQEFYQTTLKALEEAKNERLWFKTNLKLCNIWFDIGEYRRMTKILKELHKSCQKEDGTDDQKKGSQLLEVYAIEIQIYTETKDNKKLKQLYHKALAIKSAIPHPRIMGIIRECGGKMHMAERQWEEAATDFFEAFKNYDEAGNQRRIQCLKYLVLANMLMESEVNPFDGQEAKPYKNDPEILAMTNLIAAYQRNEIIEFERILKSNRRTIMDDPFIRNYMEDLLKKVRTQVLLKLIKPYTKIGIPFISKELNVPETDVTELLVSLILDSRIDGHIDEMNRYLLRGDSGNGRKLHKAVDKWNSQLKSLSSNITSRVC

Source Source

Source organism organism	Arabidopsis thaliana
Common name common_name	thale cress
NCBI taxonomy ID ncbi_taxonomy_id	3702
Host organism host_organism	Trichoplusia ni

Entity 9 Entity 9 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.32 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	69921

CryoEM structure of Plant-Complex-C-5b

1. Protein Identity and Related Structures Protein Identity & Related Structures

COP9 signalosome complex subunit 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COP9 signalosome complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COP9 signalosome complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COP9 signalosome complex subunit 6b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COP9 signalosome complex subunit 5b

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COP9 signalosome complex subunit 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COP9 signalosome complex subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

COP9 signalosome complex subunit 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9is6__assembly_1__model_1

9is6__assembly_1__model_1 | I(q)

9is6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (9)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer