SAXSdb — 9js6

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Envelope protein E

Zika virus ZIKV/H. sapiens/FrenchPolynesia/10087PF/2013

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 480	antibody heavy chain × 60 antibody light chain × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 8	antibody heavy chain × 1 antibody light chain × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 40	antibody heavy chain × 5 antibody light chain × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 48	antibody heavy chain × 6 antibody light chain × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 8	antibody heavy chain × 1 antibody light chain × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POLG_ZIKVF
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–503； UniProt 292–794 Author chain B； PDBConstruct 1–503； UniProt 292–794 Author chain C； PDBConstruct 1–503； UniProt 292–794 Author chain D； PDBConstruct 1–163； UniProt 128–290 Author chain E； PDBConstruct 1–163； UniProt 128–290 Author chain F； PDBConstruct 1–163； UniProt 128–290

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9js6
Deposition date deposition_date	2024-09-30
Structure title title	cryoEM of antibody complexed with immature Zika virus
Keywords keywords	COMPLEX, VIRUS, VIRUS-IMMUNE SYSTEM complex; VIRUS/IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9js6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9js6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9js6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	226.10 Å
Total Rg	226.10 Å
Atom count	0
Residues	0
Excluded volume	17800000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9js6__assembly_1__model_1`	480-meric （480）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9js6__assembly_2__model_1`	octameric （8）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`9js6__assembly_3__model_1`	40-meric （40）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`9js6__assembly_4__model_1`	48-meric （48）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`9js6__assembly_5__model_1`	octameric （8）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Envelope protein E
Molecular weight formula_weight	54330.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	2229

RCIGVSNRDFVEGMSGGTWVDVVLEHGGCVTVMAQDKPTVDIELVTTTVSNMAEVRSYCYEASISDMASDSRCPTQGEAYLDKQSDTQYVCKRTLVDRGWGNGCGLFGKGSLVTCAKFACSKKMTGKSIQPENLEYRIMLSVHGSQHSGMIVNDTGHETDENRAKVEITPNSPRAEATLGGFGSLGLDCEPRTGLDFSDLYYLTMNNKHWLVHKEWFHDIPLPWHAGADTGTPHWNNKEALVEFKDAHAKRQTVVVLGSQEGAVHTALAGALEAEMDGAKGRLSSGHLKCRLKMDKLRLKGVSYSLCTAAFTFTKIPAETLHGTVTVEVQYAGTDGPCKVPAQMAVDMQTLTPVGRLITANPVITESTENSKMMLELDPPFGDSYIVIGVGEKKITHHWHRSGSTIGKAFEATVRGAKRMAVLGDTAWDFGSVGGALNSLGKGIHQIFGAAFKSLFGGMSWFSQILIGTLLMWLGLNTKNGSISLMCLALGGVLIFLSTAVSA

Source Source

Source organism organism	Zika virus ZIKV/H. sapiens/FrenchPolynesia/10087PF/2013
NCBI taxonomy ID ncbi_taxonomy_id	2043570
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Genome polyprotein
Molecular weight formula_weight	18561.3 kDa
EC 编号 ec_number	3.4.21.91,3.6.1.15,3.6.4.13,2.1.1.56,2.1.1.57,2.7.7.48
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,F

RGSAYYMYLDRNDAGEAISFPTTLGMNKCYIQIMDLGHMCDATMSYECPMLDEGVEPDDVDCWCNTTSTWVVYGTCHHKKGEARRSRRAVTLPSHSTRKLQTRSQTWLESREYTKHLIRVENWIFRNPGFALAAAAIAWLLGSSTSQKVIYLVMILLIAPAYS

Source Source

Source organism organism	Zika virus ZIKV/H. sapiens/FrenchPolynesia/10087PF/2013
NCBI taxonomy ID ncbi_taxonomy_id	2043570
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	antibody heavy chain
Molecular weight formula_weight	13392.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

EVHLLESGGGLVQPGGSLRLSCAASGFTFDTYAMSWVRQPPGKGLEWVSAISTGGGSKYYADSVKGRLTISRDNSQNTLYLQMSSLRADDTAVYYCARSDFWRSGRYYYYMDVWGRGTTVT

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 4 Entity 4 polymer

Description description	antibody light chain
Molecular weight formula_weight	11501.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

SALTQPASVSASPGQSITISCTGTHFDIVDYDYLSWYQQHPGNAPKLLIYGVSNRPSGVSSRFSGSKSGNTASLTISGLQAEDEGDYYCSSYSISSTLLVFGGGTKLSVV

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	7.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	12080

cryoEM of antibody complexed with immature Zika virus

1. Protein Identity and Related Structures Protein Identity & Related Structures

Envelope protein E

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9js6__assembly_1__model_1

9js6__assembly_1__model_1 | I(q)

9js6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)

cryoEM of antibody complexed with immature Zika virus

1. Protein Identity and Related Structures Protein Identity & Related Structures

Envelope protein E

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9js6__assembly_1__model_1

9js6__assembly_1__model_1 | I(q)

9js6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

7. Citations (1)