SAXSdb — 9kh6

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Patatin

Acinetobacter baumannii

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 6	;2-amino-9-[(2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-9-(6-amino-9H-purin-9-yl)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecin-2-yl]-1,9-dihydro-6H-purin-6-one ; × 6 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A4Q7ABV3_9GAMM
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–340； UniProt 38–377 Author chain B； PDBConstruct 1–340； UniProt 38–377 Author chain C； PDBConstruct 1–340； UniProt 38–377 Author chain D； PDBConstruct 1–340； UniProt 38–377 Author chain E； PDBConstruct 1–340； UniProt 38–377 Author chain F； PDBConstruct 1–340； UniProt 38–377

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9kh6
Deposition date deposition_date	2024-11-09
Structure title title	cryo-EM structure of lipase/ligand/substrate complex
Keywords keywords	lipase, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9kh6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9kh6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9kh6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	43.43 Å
Rg (electron density)	43.62 Å
Total Rg	43.75 Å
Atom count	16206
Residues	1998
Excluded volume	290430 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9kh6__assembly_1__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Patatin
Molecular weight formula_weight	37583.7 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	16206

MEKFQILALSGGGYRGLFTATVLKELEQEAKENGHDSIADCFDLITGTSVGGIVALAIAYGIKVEAIVDLFKSHGDKIFQPKPFLKFTGSKYSNESLKTVLEEWFGDSILGDLKCPVVIPTIDFTRGSPVTLKTPHNPNLKRDWKLKIVDVALATSAAPTYFPRHPIGPNEYVDGGLFANDPSLIGLHEADYMFKKNIQDVHILSIGTLSSKKQLNPSTKKDGGYLDWGEGSILKAAPNIIDLVLSSQQQFMEQMVKHRMEPFPNQFYKIDEQIVQASAQFIGLDETSDAAKQVLEGNGIQSAKVALGKDFIRNYFNQPSRKREWFDGPQKNVGGDKLNG

Source Source

Source organism organism	Acinetobacter baumannii
NCBI taxonomy ID ncbi_taxonomy_id	470
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	;2-amino-9-[(2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-9-(6-amino-9H-purin-9-yl)-3,5,10,12-tetrahydroxy-5,12-dioxidooctahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecin-2-yl]-1,9-dihydro-6H-purin-6-one ;
Molecular weight formula_weight	674.4 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 3 Entity 3 non-polymer

Description description	1,2-dioleoyl-sn-glycero-3-phosphoethanolamine
Molecular weight formula_weight	744.0 kDa
Source method src_method	syn
Copy count entity_count	6

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	548926

cryo-EM structure of lipase/ligand/substrate complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Patatin

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9kh6__assembly_1__model_1

9kh6__assembly_1__model_1 | I(q)

9kh6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

7. Citations (1)

cryo-EM structure of lipase/ligand/substrate complex

1. Protein Identity and Related Structures Protein Identity & Related Structures

Patatin

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9kh6__assembly_1__model_1

9kh6__assembly_1__model_1 | I(q)

9kh6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

7. Citations (1)