SAXSdb — 9khy

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail sheath protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Probable tail terminator protein × 6 （Q9T1V8） Tail tube protein × 12 （P79679）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TSP_BPMU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain a； PDBConstruct 1–495； UniProt 1–495 Author chain b； PDBConstruct 1–495； UniProt 1–495 Author chain c； PDBConstruct 1–495； UniProt 1–495 Author chain d； PDBConstruct 1–495； UniProt 1–495 Author chain e； PDBConstruct 1–495； UniProt 1–495 Author chain f； PDBConstruct 1–495； UniProt 1–495 Author chain g； PDBConstruct 1–495； UniProt 1–495 Author chain h； PDBConstruct 1–495； UniProt 1–495 Author chain i； PDBConstruct 1–495； UniProt 1–495 Author chain j； PDBConstruct 1–495； UniProt 1–495 Author chain k； PDBConstruct 1–495； UniProt 1–495 Author chain l； PDBConstruct 1–495； UniProt 1–495

Probable tail terminator protein

OrganismNot specified

UniProt Q9T1V8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Tail sheath protein × 12 （P79678） Tail tube protein × 12 （P79679）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TRP_BPMU
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–182； UniProt 1–182 Author chain 2； PDBConstruct 1–182； UniProt 1–182 Author chain 3； PDBConstruct 1–182； UniProt 1–182 Author chain 4； PDBConstruct 1–182； UniProt 1–182 Author chain 5； PDBConstruct 1–182； UniProt 1–182 Author chain 6； PDBConstruct 1–182； UniProt 1–182

Tail tube protein

OrganismNot specified

UniProt P79679

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 30	Tail sheath protein × 12 （P79678） Probable tail terminator protein × 6 （Q9T1V8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TUBE_BPMU
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–118； UniProt 1–118 Author chain B； PDBConstruct 1–118； UniProt 1–118 Author chain C； PDBConstruct 1–118； UniProt 1–118 Author chain D； PDBConstruct 1–118； UniProt 1–118 Author chain E； PDBConstruct 1–118； UniProt 1–118 Author chain F； PDBConstruct 1–118； UniProt 1–118 Author chain G； PDBConstruct 1–118； UniProt 1–118 Author chain H； PDBConstruct 1–118； UniProt 1–118 Author chain I； PDBConstruct 1–118； UniProt 1–118 Author chain J； PDBConstruct 1–118； UniProt 1–118 Author chain K； PDBConstruct 1–118； UniProt 1–118 Author chain L； PDBConstruct 1–118； UniProt 1–118

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9khy
Deposition date deposition_date	2024-11-11
Structure title title	Terminator and trunk structure of Escherichia phage Mu
Keywords keywords	sheath, tube, phage, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9khy__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9khy__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9khy__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	71.54 Å
Rg (electron density)	70.81 Å
Total Rg	70.91 Å
Atom count	63684
Residues	8376
Excluded volume	1126500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9khy__assembly_1__model_1`	30-meric （30）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Tail sheath protein
Molecular weight formula_weight	53132.5 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,b,c,d,e,f,g,h,i,j,k,l
Atom count atom_count	63684

MSDISFNAIPSDVRVPLTYIEFDNSNAVSGTPAPRQRVLMFGQSGSKASAAPNVPVRIRSGSQASAAFGQGSMLALMADAFLNANRVAELWCIPQGNGTGNAAVGEISLSGTAGENGSLVTYIAGQRLAVSVAAGATGAALADLLVARIKGQPDLPVTAEVRADSGDDDTHADVVLSAKFTGALSAVDVRWNYYAGETTPYGIITAFKAASGKNGNPDISASIAGMGDLQYKYIVMPYTDEPNLNLLRTELQERWGPVNQADGFAVTVLSGTYGDISTFGVSRNDHLISCMGIAGAPEPSYLYAATLCAVASQALSIDPARPLQTLTLPGRMPPAVGDRFTWSERNALLFDGISTFNVNDGGEMQIERMITMYRTNKYGDSDPSYLNVNTIATLSYLRYSLRTRITQKFPNYKLASDGTRFATGQAVVTPSVIKTELLALFEEWENAGLVEDFDTFKEELYVARNKDDKDRLDVLCGPNLINQFRIFAAQVQFIL

Entity 2 Entity 2 polymer

Description description	Probable tail terminator protein
Molecular weight formula_weight	20576.1 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,2,3,4,5,6

MLEETEAALLARVRELFGATLRQVEPLTGTWTNEDVHRLFLAPPSVFLAWMGCGEGRTRREVESRWAFFVVAELLNGEPVNRPGIYQIVERLIAGVNGQTFGPTTGMRLTQVRNLCDDNRINAGVVLYGVLFSGTTPLPSVVDLDSLDDYERHWQTWKFPDETPEFAAHINVNQEKDHDAEN

Entity 3 Entity 3 polymer

Description description	Tail tube protein
Molecular weight formula_weight	12840.5 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,H,I,J,K,L,A,B,C,D,E,F

MAGNQRQGVAFIRVNGMELESMEGASFTPSGITREEVTGSRVYGWKGKPRAAKVECKIPGGGPIGLDEIIDWENITVEFQADTGETWMLANAWQADEPKNDGGEISLVLMAKQSKRIA

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.40 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	55035

Terminator and trunk structure of Escherichia phage Mu

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail sheath protein

State in the Current Structure

Other States of the Same Protein in the Database

Probable tail terminator protein

State in the Current Structure

Other States of the Same Protein in the Database

Tail tube protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9khy__assembly_1__model_1

9khy__assembly_1__model_1 | I(q)

9khy__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)

Terminator and trunk structure of Escherichia phage Mu

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tail sheath protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Probable tail terminator protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Tail tube protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9khy__assembly_1__model_1

9khy__assembly_1__model_1 | I(q)

9khy__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Citations (1)