9l5r

Cryo-EM structure of the thermophile spliceosome (state ILS)

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-mRNA-splicing factor SYF2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S5N3_CHATD
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain B； PDBConstruct 1–326； UniProt 1–326

SDE2

OrganismNot specified

UniProt G0RZD9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RZD9_CHATD
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain D； PDBConstruct 1–325； UniProt 1–325

Anaphase-promoting complex subunit 4-like WD40 domain-containing protein

OrganismNot specified

UniProt G0S9U7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S9U7_CHATD
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain E； PDBConstruct 1–352； UniProt 1–352

CCDC12

OrganismNot specified

UniProt G0SDJ6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SDJ6_CHATD
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain F； PDBConstruct 1–233； UniProt 1–233

Putative pre-mRNA splicing protein

OrganismNot specified

UniProt G0S620

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S620_CHATD
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain I； PDBConstruct 1–839； UniProt 1–839

Suppressor of forked domain-containing protein

OrganismNot specified

UniProt G0S0H7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S0H7_CHATD
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain J； PDBConstruct 1–687； UniProt 1–687

Putative pre-mRNA splicing protein

OrganismNot specified

UniProt G0S8A6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S8A6_CHATD
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–768； UniProt 1–768

Pre-mRNA-splicing factor SPF27

OrganismNot specified

UniProt G0SDM8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SDM8_CHATD
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain K； PDBConstruct 1–231； UniProt 1–231

Pre-mRNA-processing factor 19

OrganismNot specified

UniProt G0SFY0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SFY0_CHATD
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain q； PDBConstruct 1–480； UniProt 1–480 Author chain r； PDBConstruct 1–480； UniProt 1–480 Author chain s； PDBConstruct 1–480； UniProt 1–480 Author chain t； PDBConstruct 1–480； UniProt 1–480

Putative bud site selection protein

OrganismNot specified

UniProt G0S4Q2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S4Q2_CHATD
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain N； PDBConstruct 1–148； UniProt 1–148

Peptidyl-prolyl cis-trans isomerase

OrganismNot specified

UniProt G0S1V3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S1V3_CHATD
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain S； PDBConstruct 1–167； UniProt 1–167

Pre-mRNA-splicing factor PRP46

OrganismNot specified

UniProt G0S066

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S066_CHATD
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain T； PDBConstruct 1–496； UniProt 1–496

Cell cycle control protein

OrganismNot specified

UniProt G0S730

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S730_CHATD
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain U； PDBConstruct 1–757； UniProt 1–757

Putative pre-mRNA splicing protein

OrganismNot specified

UniProt G0RYD8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RYD8_CHATD
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain M； PDBConstruct 1–395； UniProt 1–395

Putative pre-mRNA splicing protein

OrganismNot specified

UniProt G0S7S7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S7S7_CHATD
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain 0； PDBConstruct 1–408； UniProt 1–408

Pre-mRNA-processing protein 45

OrganismNot specified

UniProt G0SF87

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SF87_CHATD
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain R； PDBConstruct 1–578； UniProt 1–578

PRP17

OrganismNot specified

UniProt G0S2N1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S2N1_CHATD
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain W； PDBConstruct 1–547； UniProt 1–547

Putative pre-mRNA splicing protein

OrganismNot specified

UniProt G0S754

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S754_CHATD
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain P； PDBConstruct 1–260； UniProt 1–260

Pre-mRNA-splicing factor

OrganismNot specified

UniProt G0SFN9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SFN9_CHATD
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain Y； PDBConstruct 1–1416； UniProt 1–1416

Small nuclear ribonucleoprotein E

OrganismNot specified

UniProt G0S8J0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S8J0_CHATD
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain a； PDBConstruct 1–98； UniProt 1–98 Author chain j； PDBConstruct 1–98； UniProt 1–98

Sm protein F

OrganismNot specified

UniProt G0RY82

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RY82_CHATD
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain b； PDBConstruct 1–94； UniProt 1–94 Author chain l； PDBConstruct 1–94； UniProt 1–94

Delta(14)-sterol reductase

OrganismNot specified

UniProt G0S405

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S405_CHATD
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain c； PDBConstruct 1–592； UniProt 1–592 Author chain m； PDBConstruct 1–592； UniProt 1–592

Small nuclear ribonucleoprotein Sm D1

OrganismNot specified

UniProt G0RZL0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RZL0_CHATD
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain d； PDBConstruct 1–118； UniProt 1–118 Author chain o； PDBConstruct 1–118； UniProt 1–118

Sm protein B

OrganismNot specified

UniProt G0SHQ3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SHQ3_CHATD
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain e； PDBConstruct 1–211； UniProt 1–211 Author chain p； PDBConstruct 1–211； UniProt 1–211

Small nuclear ribonucleoprotein Sm D3

OrganismNot specified

UniProt G0SG70

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SG70_CHATD
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain f； PDBConstruct 1–114； UniProt 1–114 Author chain u； PDBConstruct 1–114； UniProt 1–114

Small nuclear ribonucleoprotein G

OrganismNot specified

UniProt G0SI53

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SI53_CHATD
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain g； PDBConstruct 1–82； UniProt 1–82 Author chain k； PDBConstruct 1–82； UniProt 1–82

;U2 small nuclear ribonucleoprotein A' ;

OrganismNot specified

UniProt G0S6F0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S6F0_CHATD
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain h； PDBConstruct 1–242； UniProt 1–242

;U2 small nuclear ribonucleoprotein B'-like protein ;

OrganismNot specified

UniProt G0SBL9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SBL9_CHATD
Isoform	—
PDB entities	33
Chains and sequence ranges	Author chain i； PDBConstruct 1–201； UniProt 1–201

Nineteen complex-related protein 2-domain-containing protein

OrganismNot specified

UniProt G0SI54

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0SI54_CHATD
Isoform	—
PDB entities	34
Chains and sequence ranges	Author chain CY； PDBConstruct 1–510； UniProt 1–510

G-patch domain-containing protein

OrganismNot specified

UniProt G0S394

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0S394_CHATD
Isoform	—
PDB entities	35
Chains and sequence ranges	Author chain Cb； PDBConstruct 1–975； UniProt 1–975

RNA helicase

OrganismNot specified

UniProt G0RY84

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） Unknown mRNA × 1 Putative cyclophilin protein × 1 （G0RZE2） Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RY84_CHATD
Isoform	—
PDB entities	36
Chains and sequence ranges	Author chain Cc； PDBConstruct 1–764； UniProt 1–764

Putative cyclophilin protein

OrganismNot specified

UniProt G0RZE2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 45 RNA 4	U2 snRNA × 1 U5 snRNA × 1 U6 snRNA × 1 PRP8 × 1 Pre-mRNA-splicing factor SYF2 × 1 （G0S5N3） SNU114 × 1 SDE2 × 1 （G0RZD9） Anaphase-promoting complex subunit 4-like WD40 domain-containing protein × 1 （G0S9U7） CCDC12 × 1 （G0SDJ6） Putative pre-mRNA splicing protein × 1 （G0S620） Suppressor of forked domain-containing protein × 1 （G0S0H7） Putative pre-mRNA splicing protein × 1 （G0S8A6） Pre-mRNA-splicing factor SPF27 × 1 （G0SDM8） Pre-mRNA-processing factor 19 × 4 （G0SFY0） Putative bud site selection protein × 1 （G0S4Q2） Peptidyl-prolyl cis-trans isomerase × 1 （G0S1V3） Pre-mRNA-splicing factor PRP46 × 1 （G0S066） Cell cycle control protein × 1 （G0S730） Putative pre-mRNA splicing protein × 1 （G0RYD8） Putative pre-mRNA splicing protein × 1 （G0S7S7） Pre-mRNA-processing protein 45 × 1 （G0SF87） PRP17 × 1 （G0S2N1） Putative pre-mRNA splicing protein × 1 （G0S754） Pre-mRNA-splicing factor × 1 （G0SFN9） Small nuclear ribonucleoprotein E × 2 （G0S8J0） Sm protein F × 2 （G0RY82） Delta(14)-sterol reductase × 2 （G0S405） Small nuclear ribonucleoprotein Sm D1 × 2 （G0RZL0） Sm protein B × 2 （G0SHQ3） Small nuclear ribonucleoprotein Sm D3 × 2 （G0SG70） Small nuclear ribonucleoprotein G × 2 （G0SI53） ;U2 small nuclear ribonucleoprotein A' ; × 1 （G0S6F0） ;U2 small nuclear ribonucleoprotein B'-like protein ; × 1 （G0SBL9） Nineteen complex-related protein 2-domain-containing protein × 1 （G0SI54） G-patch domain-containing protein × 1 （G0S394） RNA helicase × 1 （G0RY84） Unknown mRNA × 1 Unknown protein × 1 ;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ; × 1 MAGNESIUM ION × 1 GUANOSINE-5'-TRIPHOSPHATE × 1 INOSITOL HEXAKISPHOSPHATE × 1 ZINC ION × 6	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	G0RZE2_CHATD
Isoform	—
PDB entities	38
Chains and sequence ranges	Author chain Ci； PDBConstruct 1–153； UniProt 1–153

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9l5r
Deposition date deposition_date	2024-12-23
Structure title title	Cryo-EM structure of the thermophile spliceosome (state ILS)
Keywords keywords	Spilceosome, DHX15, DHX35, GPATCH1, SPLICING/RNA, SPLICING-RNA complex; SPLICING/RNA
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9l5r__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9l5r__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9l5r__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	90.11 Å
Rg (electron density)	90.28 Å
Total Rg	89.99 Å
Atom count	104144
Residues	13299
Excluded volume	1805300 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9l5r__assembly_1__model_1`	49-meric （49）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (44)

Entity 1 Entity 1 polymer

Description description	U2 snRNA
Molecular weight formula_weight	61393.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	2
Atom count atom_count	104144

AGCUCUCUUUGCCUUUUGGCUUAGAUCAAGUGUAGUAUCUGUUCUUUUCAGUUUAAUCUCUGAAACUGCUCUACGGAGCAGAAUCGUGAUUAUACUAAUUUUUGGCCUUCGGCGGACUUCCCUCUGGGCUUGCCCAUGGUCGUCUGCCACAGUGUCCCUGGUAUUACACUGCCUCCAGGUGACGCGACCUUCC

Entity 2 Entity 2 polymer

Description description	U5 snRNA
Molecular weight formula_weight	36997.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	5

UUGGAGUAGGCCAGCUCAGACCGAACUCAUUUCCUGCCUUUUACCGGAUGUGACCGUGAGUUGGCCUGAAAUACUCCCUAACCCAAUCUUUGGAAACUCUCUGGAUAUCCCAGAUU

Entity 3 Entity 3 polymer

Description description	U6 snRNA
Molecular weight formula_weight	32443.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	6

GCCCUUCGGGGCAUUUGGUCAAUUUGAAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCACUAAGGAUGACACGCUACUCAAAGAGACGCUACCAAUUUUU

Entity 4 Entity 4 polymer

Description description	PRP8
Molecular weight formula_weight	285131.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MLRPCALAIWQGFAPLQSRESSSRFSLFKPRPVPGFHQHTTLKGEVAISNCGEIVAPISFGLWRIFANRSRSNAGNTATCLRFRRLLPDGGPPPPPPPPPPPPGPPSDLPPPPPPSSSSLPPPPAIPAPPPPGYRPPSDPHIAKFAQKKKEWLRMQRNRFGEKRKGGFVETQKADMPPEHLRKIVKDIGDVSQKKYTSDKRSYLGALKFMPHAVLKLLENMPMPWEAAREVKVLYHVNGCLTLVNEIPRVIEPVFFAQWGSMWRTMRKEKSDRRLFKRMRFPPFDDEEPPLSWSENIEDVEPLEPIQMELDEDEDAAVYEWFYDHQPLIDTPHVNGPSYKRWNLTLPQMANLYRLSEPLVSDVVDPNYFYLFELKSFLTAKALNVALPGGPRFEPLYKDIDPNDEDFGEFNAMDRIIFRNPIRTETRVAYPYLYNSRPRSVHLSWHSYPQIVYTKTEDPELPAFYFDTSINPISSRAVAPKNLTVSHEDELFGKGNIEEPEEEAFVLPAAVEPFFADEELETEDTRSAIELWWAPYPFDRRSGRMVRAQDVPLIKHWYLEHCPPKQPVKVRVSYQKLLKTYVLNELHRKRPKSMQKQSLLRTLKQTKFFQQTTIDWVEAGLQVCRQGFNMLNLLIHRKNLTYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLMREILRLTKLIVDAQVQYRLGNIDAFQLADGIHYAFNHVGQLTGMYRYKYKLMHQIRSCKDLKHLIYYRFNTGPVGKGPGCGFWAPSWRVWLFFMRGIIPLLERWLGNLLSRQFEGRHSKGVAKTVTKQRVESHFDLELRASVMADLMDMMPEGIKQSKVNTVLQHLSEAWRCWKSNIPWKVPGLPAPIENIILRYVKAKADWWISVAHYNRERIRRGATVDKTVAKKNVGRLTRLWLKAEQERQHNHMKDGPYVSSEEAVAIYTTTVHWLEARKFSPIPFPSVSYKHDTKILILALERLREAYSTKGRLNQSQREELALIEQAYDSPGTTLERIKRFLLTQRAFKEVGIDMNDNYSTINPVYDVEPIEKISDAYLDQYLWYQADQRHLFPNWVKPSDSEVPPLLVYKWCQGINNLDKVWDTSNGECNVIIETQLSKVYEKIELTLLNSLLRLIMDHNLADYITAKNNVTLTYKDMSHVNSYGMIRGLQFSAFVFQYYGLILDLLILGPQRAAEIAGPPQSPNDFLQFQDRDTETRHPIRLYTRYIDKIWVFLRFTAEESRDLIQRFLTEQPDPNFENVIGFKSKKCWPRDSRMRLMRHDVNLGRAVFWDLKNRLPRSVTTIEWDDTFVSVYSKDNPNLLFSMCGFEVRILPKCRNQNDEFPVKDSVWSLVDNSTKERTAHAFLQVTEEDIQKFNNRIRQILMSSGSTTFTKIANKWNTALIALFTYYREAAVSTVNLLDTIVKCETKIQTRVKIGLNSKMPSRFPPAVFYTPKELGGLGMLSGSHILIPASDKRWCKQTDVGITHFRAGMSHDEETLIPNIARYIIPWEAEFIDSQRVWTEYSQKRLEAQQQNRRLTLEDLEDSWDRGLPRINTLFQKDRSTLSFDKGFRARAEFKIYQLMKSNPFWWTNPRHDGKLWNLNAYRTDVIQALGGVETILEHTLFKATGFPSWEGLFWEKSSGFEASMQFKKLTNAQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFLHGKIPTLKISLIQIFRAHLWQKIHESVVMDLCQVFDQELEALSIESVQKETIHPRKSYKMNSSCADIQLFASHKWNVTRPSLLFDTKDVIEATTTNKFWIDVQLRYGDYDSHDIERYVRAKYLDYTTDSMSLYPSPTGLMIGIDLAYNLYSAYGQYFPGLKTLIQQAMAKIMKANPALYVLRERIRKGLQLYASESNQEFLNSQNYSELFSNQTQLFIDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWKTAEEVAALIRSLPVEEQPKQLIVTRKGLLDPLEVNLVDFPNISIRASELQLPFQAAMKVEKLGDMILRATEPQMVLFNLYDDWLKTISSYTAFSRLILILRALHVNQDKTKLILRPDKTVITQDHHIWPSLTDEDWIKVEMQLRDLILNDYGKKNNVNVASLTTSEVRDIILGMEISAPSLQRQQAAEIEKQQQEQAQLTAVTTKTQNVHGEEIIVTTTSQFEQQTFASKTEWRTRAIATSNLRTRANNMYVAPVDNDVDDITYVMPKNILKKFITIADLRVQVAGFLYGCSPADNDQVKEIRCIVMVPQIGGNRSVQLPQHLPQHEMLKGLEPLGLIHTMAGNELPYMSPADVTTHAKLVDAHPSWKNQNTLTVTVAFTPGSVSLSAWALTPLGYKWGVENKDPNVDNPQGFTTTMGERRQLLLSDKFKGFFLVPDTGKWNYSFMGSSFSGIEKKPYHVKLDTPLPFYSEQHRPIHFTSFNELEDIWVDRADNFA

Entity 5 Entity 5 polymer

Description description	Pre-mRNA-splicing factor SYF2
Molecular weight formula_weight	36945.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MPPAKKRKTEASQEPRPASEQQEQNGAQEEQPTVQDSTPEVESRSDDKKVSQSPTLATDPSDDTSEQPSESSTKNAALTAAQERLARFRALQARAKESSQQNLKEATKESQRLATDPSQLTALSRKHAIAAHKLLKAEIEDAGGDFERKRAWDWTVEEAERWDKRMKKKEAHRDDTAFRDYAREAEKTYKRQIRNMGAPDLEKYMREKLSAIEKAAAAGTLDIIETEDGEMIAVDKDGTFFSTANATDFAQHKPDKAAVDRLVADLRKAEEASLKRRREKLAKSGEEHGDVTYINEKNKQFNAKLARFYNKYTAEIRDSFERGTMV

Entity 6 Entity 6 polymer

Description description	SNU114
Molecular weight formula_weight	113867.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MWQRATRLRLSESFGPSTTDSNHTFPDLAATMDDDLYDEFGNFIGEEAESEEESDHGANAGVYAYDEYVDEAPEEPAEEQMDIDEEPPSNAVILHEDKQYYPTAAQVFGEGVETLVQEEDAQPLTQPIIAPVEQKKFSIQEADLPPVYFDRGFMTDLMNFPEQIRNIALAGHLHHGKTAFMDMLVLETHAIQERLDKRTGKKRDEQLRYTDVHVIERDRGLSIKAAPMSLVLSSTKGKSHLFNIIDTPGHVDFVDEVAAAFRLVDGVCLVVDVVEGVQVNTEQIIKHAVLEDIPLTLIINKMDRLILELKIPPTDAYFKLKHVIEEVNTVIENTIPGRGESKRLSPEKGNVLFACTSMGWCFTLQSFAKMYSESYGGVNVEEFARRLWGDVYFNPKKRTFTRKPIEEGAKRSFVNFVMEPIYKLYSHTISEGPEDLKRTLSKLGIFLKPSQYKADPKVLMKLVCEQFFGPSTAFVDMVIKHIPSPLEAAEKKLERYYTGPLDTKIAESMKNCDQNGPLVVHVTKLFNTIDAKSFYAFGRVMSGIARPGADVRVLGEGYTLDDEEDMVVSRISDVFIAETRYNIPTDGVPAGNFVLLGGVDNSIVKTATIVDKKFDNGEDAYVFKPLSHFTESVLKVAVEPINPSELPKMLDGIRKINKSYPLITTKVEESGEHIILGTGELYMDCVLHDLRKLYADMEVRVSDPVVRFCETVQDMSATKCYAITPNKKNTITMAAEPLDDGIAQDIESGAVKIKDPPRKVAKFFEEKYGWDKLAARSIWAFGPDEMGPNILQDDTLPTEVDKKRLATVKESIRQGFAWATREGPLCEEPIRNTKFRLIDVSLFPWWWPNYSDRSTCLLFLFLDGLPRLMEPMYSVSMTGPQSSVSMVYNILSRRRGHVLSDGPIAGTPLYRVNGLIPVIDSFGFETDLRINTPGQAMVSLVFDRWSIVPGDPLDREQVTRPLQMATAQATARDFVLKTRRRKGLSEDVTVAKFLEPEFYQSLLESGTLGEP

Entity 7 Entity 7 polymer

Description description	SDE2
Molecular weight formula_weight	35780.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MGRSSKINVLISTIEGTGLPPTLCLVLPPDSPVSSLRDELDSRLPTSASPYSTRLLLTTLSSRWVPLDSPLPISHFLPTCDPVADSDSEVDQLQNDFLHLRLAVPLLGGKGGFGSQLRAAGGRMSKRNKRANVNPEEEQGSSRNLDGRRLRTVTEAKALAEYLAIKPEMEKREKEARRKRWQEIIEMTERKQEEIRNGKRGAILDGKWVEEKEVMGERTREAVMEAMKAGAWKDNFISLGEPSSSRTVASSSSADEAMEEDEESENGSSKATTPPSEPDPAAEVKGKGKEKETPMKHPAPAAKKFFGFDDDDEFMSSDDEGGDES

Entity 8 Entity 8 polymer

Description description	Anaphase-promoting complex subunit 4-like WD40 domain-containing protein
Molecular weight formula_weight	38230.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSEKRPASDDPGEGQLVVKRQNVGSSRALTRTGDSAGALIQTTPRTSNLKAPLMELSGHTGEIFTAKFDPTGTLIASGSMDRTIMLWRVYGDCENYGVLNGHKAAILDLQWSRDGDILFSASADMHLASWDLTTGQRIRRYIGHEEIINAMDVTQRGEELLISGSDDGTIGIWDPRTKNAVDYIETDFPITAVAVSEAGNEIYSGGIDNDIKVWDIRKKAVVHTMLGHNDTITTLRVSPDGQQLLSYAMDSTARTWDIRPFAPTDRHIRTFDGAPLGLEKNLIRGSWSKDGKKIAVGAGDGTVVIWGSDTGKLLYKLPGHKGTVNCAEFAPDGAPIILSASSDRTMLLGELI

Entity 9 Entity 9 polymer

Description description	CCDC12
Molecular weight formula_weight	25360.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MSSYSSLSAAADERKARLAKLASLKRKQPEDDHPPSQDQQPEQSAAESKQEGDSSQASDPVLQHLSLRNYDPVTRGPKLGFEAPPTENLNTLTLEEKAAALEAEARRKAQEEQEAAAQARGLDITTLQPKKPNWDLKREFKQRMAVLDVRTENAIARMVRERLAEKKKAIVGASAAASGAADGAASGGGNNGKGEEGVLEGAEILEGMRMREKEEEEEARREKEAEEAEFGTA

Entity 10 Entity 10 polymer

Description description	Putative pre-mRNA splicing protein
Molecular weight formula_weight	97944.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MPSTLASDRQPDVALVCEDDAPYEQDILRNPGSIRPWLSYIEYKLQHGTLREQAFVMERACVQLPRSYKLWKMFRVNHISKLNPAIFATEYQKVNALFERALILLNKMPRIWEMYLKFLMQQPLVTFTRRTFDRALRALPITQHNRIWALYRPFANSAEGITAVKIWRRYMQVHPEDAEDFIELLIQCGLYTEAVKKYIEILNNPKFQSKNAKGHYELWSEMVDLLVEHAVDIETGHETGIDVERIIRSGIERFSDQRGKLWSGLATYWIRRGNFDRARDVFEEGITTVMTVRDFTMIFDAYVEFEESVIGTLMEAASRRAEKGVVDESADFDLDIRMMRFEHLMDRRPFLLNDVLLRQNPNNVAEWEKRVALWGDNKEEVVKTYTDAIAAINPKKAVGAFHLLWANYAKFYEKAGDLRTARIIMEKAVKVPFKSVNELADMWIEWAEMELRNKNFDEAVRIMAKATQAPKRSTVDYFDESLSPQQRVHKSWKLWSFYVDLVESTSSLEETRKIYERIFELRIATPQTVVNYANLLEEHHYYEESFKIYERGLDLFSYPVAFELWNLYLTKAVDRKISIERLRDLFEQAITDCPPKFAKVLYLMYGNLEEERGLARHAMRIYERATRAVADEDRADMFNFYITKSASNFGLASTRPIYERAIATLPDNEARDMCLKFADMEKRLGEIDRARAIYGHASQFCDPRTNPEFWAKWEQFEVQHGNEDTFKEMLRVKRSVQAKYNTDVNFIASQALARSQMLKQQQQQQQQQQQQQLQQQQQNGSSGAGDPEVADAMAQLERQARAPAGFVAASENIKGTIAPSTQSVEVSNPDAIDLDDMDE

Entity 11 Entity 11 polymer

Description description	Suppressor of forked domain-containing protein
Molecular weight formula_weight	82195.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MESSRGPPRVKNKAPAPIQISAEQLLREAVDRQETIIHKPTQRFADLEELKEYQGRKRREFEDYIRRNRLRLQNWFQYAQWELEQKEFARARSIFERALDVHPNNTQLWIRYIEAELKNRNINHARNLLDRAVTRLPRVSKLWYKYVYVMEMLGDIPGTRQVFDRWMKWEPDEDAWNAYIKLEKRYGEYERARQIFAAYTQVHPEPRTWLKWAKFEEEFGTADMVRDVFQSAIQYIAETLGDDAVDERLFIAFARFETRQKEYERARAIYKFGLDNLPRSRSMQLHAQYTTFEKQFGDKEGVEDVVLTKRRRLYEEQVKENPKNYDVWFDFARLEEMGGDPDRVREVYERAIAQVPPTQEKRHWRRYIFLFLFYAIWEEKDAKNIERARAIYDTCLNLIPHKKFTFAKVWIAKAHFEIRQGNLTAARKTLGRAIGMCPKDKLFREYIAIEQKLYEFDRCRTLYEKHALFNPANCQTWIRWAELERGLDDLDRTRAIFEVAISQPVLDMPEVVWKAYIDFEEEEGEYERARALYERLLQKADHPKVWISYAQFEINIPDTETEAQAAEGEEIPVSEAAKARARGVFERALKSMKERDLKAERVALLRAWLEFERTHGAAEDVERIRRQMPREVKKKRRIDEDTWEEYVDYVFPADEQQTKNLSNLLAMAKQWKEKTGGGIMGLGAGGS

Entity 12 Entity 12 polymer

Description description	Putative pre-mRNA splicing protein
Molecular weight formula_weight	86636.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MPVVKGGVWTNIEDEILKAAVSKYGLNQWARVSSLLARKTPKQCKARWNEWLDPSIKKIEWSREEDEKLLHLAKLMPTQWRTIAPIVGRTANQCLERYQKLLDEAEQREASELGLTGPDGGETRAPTAEDVRKLRPGEIDPDPETKPARPDTIDLDEDEKEMLSEARARLANTQGKKAKRKARERQQEESRRLAALQKRRELKTAGINIKITTRKKGQMDYNADIPFEKKPAPGFYDTTEEIARNEWQRAHFDPKKQQVGNKRKSDEEEEAERKKRKNNKDGPSASLQAALKAGQMQKLREAEQSSKRKPLILPAPQVSDSELDEIVKMGMIGERASAMARESENDATRGLVGNYSTLNTGAPIRTPRAPAQEDHIANEIRNIKALTETQSSLLGGENAPLAEGAGTTGFESVVPKKQVVSTPNPLATPLRQGPNGGATPLRPGQTPLRTPRDTFSLNATDGVSMEHALRQQLKQKLAALPKPKETEWELELPEEKQEPKTQEELEEDAADRDRRERELREARELAERRRRTQVMQRELPRTAVVDIDALLRAADEIEDPARALVAREAALLMAHDAAKYPLPGAPPGVKPVEIPRFSDDELAEARLQILMEMKEKPAPEVVHAIWNRREENLNALRLGLGYYDSDSEDGEDDVANIRATLEAALDRLMASAEKGNKLEKKLNLHLGGYKNRAEMLRKKLGEAHAALEKARNALAGFQVLRASEEQAIQRRLEALRAEVAFVSTRERKAQELYRKLRDELEELRLEQA

Entity 13 Entity 13 polymer

Description description	Pre-mRNA-splicing factor SPF27
Molecular weight formula_weight	25550.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MPAITTVHESLPYIDPEPTPEQRAAAEALIAEERAKVPDDPYHALLPPPLPPLNESRHLTPILQNELARLASSPDPQAAKMDALDFSRYEAPEMPSIDSSQSLEETASQLWETLKQAYTAQAYLSARRAHLALLDTHGKNAWLIGNWHLEGEVKAVEKELAETKREIDRVSLARQGMQEAAGAELKSLEETWKAGVGRVLETEAAAEKLRIEVLEERRRLAEAQAALAVGN

Entity 14 Entity 14 polymer

Description description	Pre-mRNA-processing factor 19
Molecular weight formula_weight	51844.3 kDa
EC 编号 ec_number	2.3.2.27
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	q,t,r,s

MLCALSGEIPEEPVVSKKTGVLFEKRLILKYLEEHNNIEPGTTEELDPETDLLPIKTSRVVRPRPPNFTSIPSLLKAFQDEWDALVLETYTTREQLARVREELATALYQHDAAVRVIARLTRERDEAREALARLTVTGAAPAAQNGEAMAVDSESLSEGLVEHVNEVQQQLMKTRKKRPIPQGWATADDVAALQQVAYTDLNVTQASSLDLENECAAVGGLDGKLDIYSVVANKVERTLDIGEPVTATEWTGTKVVIGTAKGWVKVYDAGRESATFQTHAGPVTGLAVHPGGRILASVGVDKSFVFYDLETGERVARGYADAALTTCAFHPDGNLFAAGTQTGHILVFHTTTLEQAESFPLGTPIQALAFSENGFWFAATGKGTSSVTIFDLRKSGAAAAVKELQTGEVLSISWDYTGQYLATGGGTGVTVQMYTKATKSWSEPVRLGMPVVGVKWGGEAKRLVVVSREGVVSVLGKKEE

Entity 15 Entity 15 polymer

Description description	Putative bud site selection protein
Molecular weight formula_weight	17176.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MPAIRPASKRKPPPDGFSDIEEDLLIFANKMKDAQNTPTDNIPKHQAQWPIFQIAHQRSRYVYELYYQKQAISKQLYDWLLKNGYADAMLIAKWKKQGYEKLCCLRCIQTKETNFNSTCICRVPRAQLKEDQDIQCVNCGCRGCASTD

Entity 16 Entity 16 polymer

Description description	Peptidyl-prolyl cis-trans isomerase
Molecular weight formula_weight	18361.8 kDa
EC 编号 ec_number	5.2.1.8
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MATDVALETTMGTIILELYNQHAPRTCENFKTLAARGYYDGTIFHRVIKDFMVQGGDPTGTGRGGRSIYGDTFEDEIHPGLRHTGAGILSMANAGPNTNGSQFFLTLAPTPWLDGKHTIFGRVKKGIRVLQRMGLVPTDADDRPKTEIKIIRAYVVGEGEEDDKQLV

Entity 17 Entity 17 polymer

Description description	Pre-mRNA-splicing factor PRP46
Molecular weight formula_weight	54207.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MATDVAVNGPDVSKLEALLRDNERTTRSLYASTTPDSGRKRIKLDPGLASEDPDITKSALSLRLHAEYGDVQTLPEAIAKKLSAAGPRKKKPKPGVAEDEAPSKSEEHTRKLIEGIPQAKPSAGAASSNALVLAHGKPSAAGAGAARPQRNEPQQLSLVRRSESLLAQPRPDWHPPWKLMRVISGHLGWVRALAVEPNNQWFASGAGDRTIKIWDLASGQLRLTLTGHISTVRGLAVSPRHPYMFSCGEDKMVKCWDLETNKVIRHYHGHLSGVYTLKLHPTLDVLVTGGRDGVARVWDMRTRSNVHVLSGHTGTVADLVCQEADPQVITGSLDSTVRMWDLAAGKTMGVLTHHKKGVRALVTHPTEFTFATASTGSIKQWKCPEGAFMQNFEGHNAIINTLAVNDQNVLFSGGDNGSMSFWDWKSGYRFQSLDTTAQPGSLDAELGIMSSTFDMSGARLITGEADKTIKIWKEDTTATPETHPIEWKPSLVRRKY

Entity 18 Entity 18 polymer

Description description	Cell cycle control protein
Molecular weight formula_weight	88163.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MELDGLAAFEKALAAEKAERERAAREKEERRERKHRHHHHHHRSRSKSPKRDRDSDRHKHRSRSRDRDRHRDRDRDHDRHELPGRDGEKDRRSRHLSRERDSDEDRHRDRHSRRSRDEGDRDRSDRHRHRRRSRSRSKERDRDRYDKHTVKDTKDLKSSDPKADLPLPDEEKTPAGSTPLVRDAWMTAPSAMDIDYIHRRQKDKSPSPVREEPRLVLHKRELNTRLADDDWKEPAPAKKREVNYTFGDEGSEWRMTKLKGVYTIAEQTGRSVEDVALERYGSLEVFDEAMEEKMELDRRKLYGPGYVGKEKPTGNLYRERMAKTRPQPARSPSPEPQQGLVIEDKIQPAPPMDQSALNRLRAGYLRAKFRKAPEAAKLEEEYNKAAAAFTTGAASNNAIVLDASYNRMLAGPRHEVKAVTTKRGRERGQVEANEDMTIEDMISEERRTRGQPGGEGLRLAERIAKDARFENDLEYLEENAEWLAKRVHKTDLSLKNIAVNEYQKLNRILETCPLCYHEDRNPPQNLPIAPVISLGTRTYLTLAPEPEINGAEGGAVIVPLTHHTNLLECDDDEWEEIRNFMKSLTRLYHDQGRDVIFYENAAAPKRRQHAALVAVPIPYELGDTAPAFFREAMLSSDEEWAQHRKVIDTGKKAKEALGRMAFRRSIAKEMPYFHVWFNLDGGLGHIVEDENKWPKGDLFAREVIGGMLDAEPDVIKKQGRWTRSDERVEGFKKRWRKFDWTRVLTEGIVVQTDGASV

Entity 19 Entity 19 polymer

Description description	Putative pre-mRNA splicing protein
Molecular weight formula_weight	42241.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MPPQIKQDLNRAGWESTDFPSVCENCLPENPYVKMLKEDYGAECKLCTRPFTVFSWAGDGRAHGRKKRTNICLTCARLKNACQCCIMDLQFGLPIVIRDKALELIAPGPQSEINREYFAQNNERAIEEGRAGVEEYEKTDEKARELLRRLANSKPYFRKGRELDSEGNPVAGGSGSTVGGNAVVGAGLGGAGPIRTRDTRAAAAAGARTGGAGSARRGPGAALPPPGPKDWLPPADKSIMSLFITGIEDDLPEWKIRDFFKQYGKIKSLVVSHMTHCAFVNYETREGAEKAATELKGRAVIAGCPLRIRWSIPRPIGTMNKEERAEMLRDGRSAFPEANRKSAQKAIEAAGAQGGAAGGAAGGAAAEAQQDDLADLAIAAPPGAADVQYASLAGN

Entity 20 Entity 20 polymer

Description description	Putative pre-mRNA splicing protein
Molecular weight formula_weight	45885.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0

MAELETNPDVAVAVAEDSNEQKQENQLVAVNNEVAAPIEKKVKKIIRKKRRPARPQIDPALVKSERPPQTGTVFNIWYNKWSGGDREDKYLSQTHAKGRCNIARDSGYTRADSRPGSYFCLYFARGICPKGQDCDYLHRLPTIHDIFNPNVDCFGRDKFADYRDDMGGVGSFNRQNRTIYVGRIHVTDDIEEIVARHFAEWGQIERIRVLNNRGVAFITYTNEANAQFAKEAMAHQSLDHNEILNVRWATADPNPLAQKREQRRIEEQAAEAIRRALPAEFVAEIEGKDPEARKRRKLESSYGLEGYEAPDAVHFARGPNAVNPRGREGFELEREQQLMLEAPPETSQPAQIEAPPQAQEKKLAGGILSSRTLAALQGAKVAVATKDSKPEKPSGPLVAYGSDDEEDE

Entity 21 Entity 21 polymer

Description description	Pre-mRNA-processing protein 45
Molecular weight formula_weight	65194.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MASIAAGLAAALPKPKYSSEHEEPRATQRGPRIVSADQIDETQIVIRRTGPPPYPNRAGWRPRAPEDFGDGGAFPEIPVAQYPWGKNDSSSKSNALVVQVDSEGKVDYTAIARQGHSSDRIIHASFKDLIPLRQRAEAGQIDLSRPSKEEVEATAERTKNALAALVSGALAAQKPKNVQVNTKREATFVKYTPSAQMGNNTKKQERIIKIVERQRDPMEPPKFKHKKIPRGPPSPPPPVMHSPPRKLTAEDQEAWRIPPPVSMWKNPKGFTIPLDKRLAADGRQLQEVQINDKFAQFSEALFMADRHAREEVRQRAMMQQRLAEKERQQKEEHLRQLAQQARAERAAAAASGRRRSTRSRSGSYSGSESGSETDESERERRRARREKLKEEERKLRQSRMGAERRAQVLAREMDRDISEKIALGIAKPTMSGESMYDSRLFNQSSGFGATINEDNPYDKPLFAAQEAISSIYRPRTNAEYEDDEEAGEKEMERIRKGNRFGEALGRGTFKGTEDAQPREGPVQFEKDTETADPFNVDKFLSEVQKGSNSGGGKRGYGLQDEDSRQAKRSRVDDDENDD

Entity 22 Entity 22 polymer

Description description	PRP17
Molecular weight formula_weight	61222.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MPDFGEYPPNLPVRDALILRESQAQAPTANHAVVPYTGENLARPSYGPANPFRDTSSSSASASGSLKRKNNVLTGHAEEMYISEATFRAKHRAVEAVGGGVMRSNREMKEVNKRLREMREDKGSATIADGEGAYIGPWARYKRREEYEVVDKKGEEEDGDEYEEVEVTDEEEEVIESGTVLKAPEPAIARRKEAEEMGEERTEFLGESEYDYLGRTYMHVPQDLDVSLNKEVGSITNYIPKKLIYTWRHHGGKPITALQLFPRSSHLGLAGSADGVVKIFDVYRGRELLRSYSGHNKAITDLSFCNDGTKFLSGGFDRKIRLWDTETGQCVNRFNIGKTPHVIKFNPSSENGHEFLAGLSDKRIVQYDTRAGNDTVQEYDRHLGPINTIEYIDENRRFMSTSDDRSLKVWEYGIPVEIKTISEPDMFALTKSAQHPNGKYVLYQCSDNSIVAYSCSGDKFRQHRKKAWRGHNTAGSAIGLTCSPDGQFVASGDTSGSVCFWDFKTCKLYSKLTADSAGGIINCVAWSEQETSKVFTAGAKGEIKLWD

Entity 23 Entity 23 polymer

Description description	Putative pre-mRNA splicing protein
Molecular weight formula_weight	28956.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MTTAHRPTFDPARGKEALRGPAYHQRLLPAYTTLKFRQPGQGGAADKSTRDLRAELEAAEAAHYAKLKGAPIPGTSSSSENNTPAIAGSSASSVTGKRPLPSSSNGGGDRPPDDGDEDPEAKRRRILAETRDIDADDDSSSGSDKDSDSESGSADSDDSSDDEEAELQRELERVRRERMEKRAREEAERKAAEEARREEEIARGNPLLNKPDFTVKRRWDEDVVFKNQARGTEDKGKRKEFVNDLLRSDFHKRFMSKYVR

Entity 24 Entity 24 polymer

Description description	Pre-mRNA-splicing factor
Molecular weight formula_weight	161045.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MPPAKRIKSSADSRPNAGASGRPTLEDLEGENQFTNLARQHWLNVPQQAAKIKVKTDVLKRELYLWPGYGEDSSNYHVLLIILIVNAKRRERVSTWDIFADRPADFSDLFRRALSMTLDSSLSWTIRTHVLLFIIHAFQSLDYAIVRKECAPLVSISIWHNLSTEEKREALLDSNPHLRKAWRAATKRFESADDATKARLRFDRAWLYSLVLDFLTLLYSGNAKQEHVLYCERFVEFLTDLQSQLPTRRYVNTLLQDLHVLPALSLSPIYNDEGNGLLRELCNLFTHYTYFAVDDQSGVQLSREQAYDRHCAILAKLQRIAMKHFKEKLTVLALSNYGSIDKRSELEPLLQALTDDELVQLSNLMNIRTSYPDAARIPVDRKFIVEVLLTTFERRKTFQDAAQALSVLPTEETLFDISLKRTDQYDGSRPLALPKLNLQYLSVGDFLWRSFVLYRCESFYAIRQDLEDALIRLKPEVRRGGVTGFAGFSKMALPISKPVILDVMPPQVGDDKPSCVKAEVTIDLRRLTPQIRRDWESLRPDDVVFLLAVDASRQKQSANGGAVLSEAERLGLVHVRAAEIIQVLDDKGKAIRDPQAYFDGHTRSDIRKIQLRLDATSYKADTEANRNVYEDINLIVRRSSRENNFKPVLESIQDLTLSEVPLASWLHEVFLGYGDPAGATFKQLPNRLKKINFRDTFLDWQHLVESFPGKIIEPSDDVSSSFGPPYVLESVEKQVEEHPSKPSKKRRRDVEPALMSKVETLKVSTYKPPNNGPYPVDAPKLNKIRFTPTQIDAIYSGTQPGLTIIVGPPGTGKTDVAVQIISNIYHNFPEQKTLLVAHSNQALNQLFAKIVALDIDERHLLRLGHGEEELETEGSFSKHGRVESFLDNRQRFLYEVSRLAASMGAPGAHGNSAETAGYFNKVYVEPAWAKFNDIIQREDVGPEDIVRAFPFHAYFSDAPQPLFPPEADRETVLEIANGCYRHISKIFEELADVLPFEILRRDKDKANYLLTSEARIIAMTSTHAAMKRGEIASLGFQYDNVIMEEAAQITEIENFIPLALQKPKNGQMALQRVVLCGDHYQNSPVIQGLAFRHYANLEQSLFSRLVRLGVPTINLDQQGRARPSISNLYRWRYPQLGDLPHTQTEPEFLTANAGFRYDYQFVNVPDYRGMGESEPTPHFIQNLGEAEYAVAIFQYMRLLGYPASKISILATYAGQKALIKDVLAHRCAKNPIFGLPRVVTTVDKYQGEQNDYIILSLTRTTRVGYLRDLRRLTVALSRARLGLYILGRRAVFESCYELRDAFSLLLRRPDKLALVTGELWPSKRLLADETDDTKKLEGEVVMEGVEHLGQWVFEMTKTKIAELRKEKGLSEEVPVEMPKEVVSAEADEGYLPLDEEEGDGEEGEGERVKGFEIEDS

Entity 25 Entity 25 polymer

Description description	Small nuclear ribonucleoprotein E
Molecular weight formula_weight	10967.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	a,j

MTSRGAPAGRRVLLPPINFLFRLLQQRTPVQIWLYEQLAIRITGVIRGFDEFMNLVIDDAVEIKLSPKTNEPESKRPLGQILLKGDNISLIQALSGSA

Entity 26 Entity 26 polymer

Description description	Sm protein F
Molecular weight formula_weight	10727.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b,l

MNTGFVPVNPRPFLQDLVNQDVIVRLKWGQTEYKGRLVSIDSYMNIQLANTEEFINYKSTGHLGQVLIRCNNVLWVTAAAGKQMTPTEDTKMEE

Entity 27 Entity 27 polymer

Description description	Delta(14)-sterol reductase
Molecular weight formula_weight	66785.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	c,m

MAPKTKKQAVSRTQHYEFFGPPGAAAISFGLPLLVYAFAFACNDITGCPAPSLLHPKSLKLDVLKQEVGWPKNGIWGLASWRVTGWTLAYYLWLALLYRILPGDVVEGTQLRNGGRLKYKLNAFASSMFTLVICAAGTIAQGADFPLWTFIADNYVQILTANVIIAYTLATFVYIRSFSVKPGNPQLRELAVGGVTGNILYDWFIGRELNPRVTLPIIGEIDIKQWMELRPGLLGWTLMNCAFVAKQYRLYGYVTDSIVFVTAVQALYVLDSHYFEPAVLTTIDITTDGFGLMLSFGDIVWVPFIYTQSTRYLAVHPQKLGYLGLVGVTVLLVAGFAIFRLSNSQKNAFRTNPNDPSVKHLKYIETKAGTRLLISGWWGIARHINYLGDWLQAWPYCLPTGLAGYQILTAGSELAEGAVKMLDGRIVVPGEARGWGTIFTYFYVVYFATLLLHRDRRDDEKCSKKYGEDWEKYKEIVRWRIIPALLQKPRSECTEWEIAQIEEWEMANGPLSLLQTAVRSHTQVLISVRSGRKLLARVKAFDRHCNMILENVKEMWTETPVTNGKKGRPVNKDRFISKMFLRGDSVVIVLLS

Entity 28 Entity 28 polymer

Description description	Small nuclear ribonucleoprotein Sm D1
Molecular weight formula_weight	13033.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	d,o

MKLVRFLMKCANETVTIELKNGAIVHGTIASVTPKMDTALRNVRYTPKGEEPYSVESLTVRGNTIRYYILPDSLPLDTLLIDDAPKPKNKARKEADRGRGRGRGRGGRGGRGGRARGR

Entity 29 Entity 29 polymer

Description description	Sm protein B
Molecular weight formula_weight	21425.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	e,p

MSSSQNRQGKMAGYINWRMRVTLNDGRQMTGQMLAFDKHMNLVLADTEEFRKTKRMQAKPNSSTTQTLIQEEKRTLGLTIVRGANIIALSVESPPPADPSARLGKTTGAGIASTLTAGPGVARPAGRGAAAPISLAGPAPGVGGAVPPPPFPGFPAAAPPGFPGRGGPAPPGFPAAPFPPPAGFPGAPGFPPGFPPGGAPPPAGFNPPPRR

Entity 30 Entity 30 polymer

Description description	Small nuclear ribonucleoprotein Sm D3
Molecular weight formula_weight	12708.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	f,u

MTSSIGIPIKLLNEAQGHIVTLELTTGQTYRGKLIEAEDNMNVQLKDITVTARDGRVSHLEQIYIRGSHVRFFIVPDMLRNAPMFRSRNVRGRGVGLARGRATVSRARASGRGR

Entity 31 Entity 31 polymer

Description description	Small nuclear ribonucleoprotein G
Molecular weight formula_weight	9259.8 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	g,k

MAPAQPELKKYLDKRLFVELNGSRRVIGVLRGYDVFLNIVLDDAVEERPNGEKVKLGMVTIRGNSVVILEPLERIGDDRPGR

Entity 32 Entity 32 polymer

Description description	;U2 small nuclear ribonucleoprotein A' ;
Molecular weight formula_weight	27249.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	h

MRLTAELIQNSLSYLNPLKERELDLRGHRIPAIENLGVAGPHDAIDLTDNDIQVLGNFPLSPRLRTLLVARNRVAMIHPTLPNAIPNLRNLVLASNNLTELSDLDVLGKFPRLTHLVLMDNPVTKKEVKDAERNKAKELFGTAEAPTELAAKIMGIKSKTFDVTAVPNGETQKSKLSRLKLTEKERKKLQEMIKKATSLEEIIRLEKYLNEGRLPPGIMVVEDAMEEHISMTSQSVDIWDRD

Entity 33 Entity 33 polymer

Description description	;U2 small nuclear ribonucleoprotein B'-like protein ;
Molecular weight formula_weight	21744.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	i

MSTRGAPPPNLPAKVAAIPPNQTLYVTNLPSAKIQKEDLRTALYMLFSTYGSVLDVVALKTMKMRGQAHIVYKDIQTATMAMRALDGFEFLGRPMKISYAKGKSHIIAKLDGTFKPPTAAKEVEVTDLQHSIFNAPVPGQPGSVTAPAKSSSLPPKPPGGGDQPMPDVGATETRGVKRPREEELEEESDQDVAMEEESDED

Entity 34 Entity 34 polymer

Description description	Nineteen complex-related protein 2-domain-containing protein
Molecular weight formula_weight	56472.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	CY

MAAFGAKRKPRIIKAFDDDDEDLSLPLSSGGEDKQAGEELPPPARIKFGRTKFTKSSALRKNAMIGNDDTDSPNATSARDDDDDDENSGAPVVVRPSSVNKGSLSKIKKRPAASRLSFGPSAGAEDDDEEAEVVIQPRKMLNQRAVENSALRANSSLPTRFGGEENRPKYSKEYLAELQSATFNTPQNLADLKIHDDDEMQLDEMELEGALIVPSNEVAVPGASTTQTTHIPTEAEIRERKERRARLAHEAKFIPLDDEFNSDNEGAQPSHPILNLPSKQKRRDTRLIREDEDLYEGFDEFVSDGNLALGRKAEKAVLQRHRQEMAELIEAAQAEDNDEAASDDSEAEERAAYEEAQVRAAMDGLRGKYREEHLERGGGADLYEGRGPDDIPRMKPLPKLGDVLQRIREAIQGLEGEVVRKRSRIEGLEKEKAEILVREKEVQEILNQAGQKYQEVVGGLGVHNVPKIVAGQSPLRPFPPGLAREMPTERGLESYGATPIRRYGGEEDDG

Entity 35 Entity 35 polymer

Description description	G-patch domain-containing protein
Molecular weight formula_weight	110801.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Cb

MARLDDLQFDPARLKNSSVDAYSSSDSDGDSDSDDYVIPSRNPHDDEFADYNPRKRRRTGRDPKESAALGIFAEDSDEDEGPARRWKHKPLRNRGVNFVSGGQQKKEEDSSESDEEESNDDERKQQEAVDNEYDDDDPGGVPAALTEDDVDEDEDDEMGGVGLGFKPSSTSATSQPQGGLGWTLPTQQETTTKKPPPFQRFVKSKIDPSNPLGPGFTPTSARAPTLLARNDEPTPPRTALPSAFQPTKDGKTKINPNSFGARMLAKMGYKEGQGLGKDGQGRNVIIEVNLRPQGVGLGAVKEKTKQEREEEKRQARLRGEEVIDSSEEERKKKAAKKKKGLAGKIGSGSGSGASTPRPQKPKYLTMEEIKKVAPGLHIPEAFTPILDMTGPEKKLLTSTSGLMTPTGGTGAAPTAESVEAAEKRKLIKRAQADFMAILEEWQSLQERKAYIDLQLQQERQELEELEASLQGNRSVTTACETALRPPESGELDQKKDLEYRLERIIAGLASATTSLIVGTMLPQVRDELGALAVAAIHPLFNQFRQLWDPLEEPKPSFVDGMKEIRSLLGLDQKPKKKTYRKPSATPYETMMYELWLRTVAASVREWDVREPEPLIAVLEAWDALLPGFVRAQLLRDVVRKLEEAVEKWQPRKHTHNLPHRWIFPWLPYLPASHLDAKAATGLVADVRRKFRTLIDAWDFSRGVIPGLKHWKQVLWPEHGRSSDYWTPLMMNHLLPAMAKYLRQKFRVDPRDQGPYIDILDKVFEWTEVIRPEMVGEVIVAEVFPMWHDALYQWLLLEDANYEEIGQWFEWWQDQVFPDDIKALPSITAEFEKGTAMIERALDLGNRAKDELKPPERGPALRTGREERRRTEKEREREREREKEKERATVGKPPEEITFRQVLEEWCQEHDLQFMPERNKIHAEGPLYRISGPDGKKGVSVYFKGNSVFVLMKDRKPLEFRRDDEAEWGILLDMVY

Entity 36 Entity 36 polymer

Description description	RNA helicase
Molecular weight formula_weight	87155.5 kDa
EC 编号 ec_number	3.6.4.13
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Cc

MADITKGTKRLSGEAEGSQDSKRVKTNGDKMDAKNPYLAHLEEKPEADFESLLDKLERRNTTAKQAEAVEDSDINPWTGQRHSERYFKILKARRKLPVNKQRQEFLDLYHNNQILVFVGETGSGKTTQIPQYVLYDELPHQTGKLIACTQPRRVAAMSVAQRVADELDVKLGEEVGYSIRFENKTSSKTLLKYMTDGQLLREAMHDRDMSRYSCIILDEAHERTLATDILMALLKQLSERRKDLKIIVMSATLDAQKFQSYFFNAPLLAVPGRTHPVEIFYTPEAERDYVEAAIRTVLQIHACEPEGDILLFLTGEEEIEDACRRISLEVDEMIRESDAGPMSVYPLYGTLPPHQQQRIFEKAPQPFRPGGRPGRKCIVATNIAETSLTIDGIVYVVDPGFSKQKIYNPRTRVESLLVSPISKASAQQRAGRAGRTRPGKCFRLYTEEAFKKELIEQTYPEILRSNLSNTVLELKKLGVEDLVHFDLMDPPAPETMMRALEELNYLACLDDDGELTPLGNLASEFPLDPALAVMLISSPEFYCSNEILSITSLLSVPQIWVRPANARKRADEMKAQFAHPDGDHLTLLNAYHAYKGAEARGEDMKKWCHEHFLSYRHLSSADNVRAQLKKIMETHGIELVSTPFHDKNYYTNIRRALLAGFFMQVAMRESSNSKVYKTVKDEQLVLIHPSTTVTTPYEWVVYNEFVLTTKQYVRTVTNIRPEWLLEIAPVYYDLSTFQKGEIKNALTRVAEKIRRQQAMKASKA

Entity 37 Entity 37 polymer

Description description	Unknown mRNA
Molecular weight formula_weight	22185.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	7

GUAXAXAXNXXXXXNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNXXAXAXXXAXXXX

Entity 38 Entity 38 polymer

Description description	Putative cyclophilin protein
Molecular weight formula_weight	16600.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Ci

MSDAARWKATVYVGGLAPAVTATVLHEAFLPFGEIAEINLPRNENPNTASTEPHRGFAYVEFEDPEDAKEAIDNMDQSELFGRVIKVSAAKPPKSAGQGLGSKTAVWEQEGWLAEHAVSEEDRLAAERAKNARPNEDPMQGLEDLDVAGPKPE

Entity 39 Entity 39 polymer

Description description	Unknown protein
Molecular weight formula_weight	1890.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

XXXXXXXXXXXXXXXXXXXXXX

Entity 40 Entity 40 non-polymer

Description description	;N,N,7-trimethylguanosine 5'-(trihydrogen diphosphate) ;
Molecular weight formula_weight	487.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 41 Entity 41 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 42 Entity 42 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 43 Entity 43 non-polymer

Description description	INOSITOL HEXAKISPHOSPHATE
Molecular weight formula_weight	660.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 44 Entity 44 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	6

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	77668

Cryo-EM structure of the thermophile spliceosome (state ILS)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Pre-mRNA-splicing factor SYF2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SDE2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Anaphase-promoting complex subunit 4-like WD40 domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CCDC12

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative pre-mRNA splicing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Suppressor of forked domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative pre-mRNA splicing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-splicing factor SPF27

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Pre-mRNA-processing factor 19

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Putative bud site selection protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer