← Back to search

9q8q

;Protein kinase CK2 catalytic subunit alpha' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment E03 ;

Method: X-RAY DIFFRACTION D_max: 69.4 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9q8q
deposition_date	2025-02-25
last_revision	2026-01-14
title	;Protein kinase CK2 catalytic subunit alpha' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment E03 ;
keywords	fragment-based screening, protein kinase CK2, casein kinase II, TRANSFERASE; TRANSFERASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	21.71 Å
rg_electron	20.45 Å
i0	24914500.00
molecular_weight	39209.0 kDa
excluded_volume	49519 Å³
envelope_volume	56721 Å³
shell_volume	22968 Å³
envelope_diameter	70.3 Å
shell_rg	27.38 Å
envelope_rg	20.69 Å
shape_rg	20.43 Å
total_rg	21.44 Å
total_atoms	5517
n_residues	327
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	69.4 Å
rg_real	21.61 Å
rg_real_error	0.38 Å
i0_real	2.4910e+07
i0_real_error	3.1310e+05
rg_reciprocal	21.63 Å
i0_reciprocal	24910000.0000
total_estimate	0.8975
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	25.9 Å
skewness	0.237
kurtosis	-0.382
angular_range	— – 0.3650 Å⁻¹
current_alpha	0.0000
highest_alpha	7718000.0000
n_real_points	68
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.888; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.999

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	;Casein kinase II subunit alpha' ;
formula_weight	43432.5 kDa
ec_number	2.7.11.1
mutation	C336S
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	5892

MGSSHHHHHHSSGLVPRGSHMPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPSADNAVLSSGLTAAR

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli

Entity 2 non-polymer

description	1-phenyl-1,3-diazinane-2,4-dione
formula_weight	190.2 kDa
src_method	syn
entity_count	1

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	336

▶

6. Citations (1)

▶

length_a	46.510 Å
length_b	47.796 Å
length_c	50.507 Å
angle_alpha	113.18 °
angle_beta	90.02 °
angle_gamma	91.18 °
z_pdb	1

space_group	P 1
int_tables_number	1
crystal_system	triclinic

resolution	0.980 Å
resolution_low	33.010 Å
r_factor	0.1483
r_work	0.1479
r_free	0.1794

fit	/app/data/saxs_computation/q8/9q8q/9q8q.fit
pddf	/app/data/pr_computation/q8/9q8q/9q8q.pr.out
profile	/app/data/saxs_computation/q8/9q8q/9q8q.dat

;Protein kinase CK2 catalytic subunit alpha' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment E03 ;

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction