← Back to search

9qd0

Structure of Beilong paramyxovirus receptor binding protein

Method: X-RAY DIFFRACTION D_max: 105.0 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9qd0
deposition_date	2025-03-05
last_revision	2025-11-19
title	Structure of Beilong paramyxovirus receptor binding protein
keywords	Receptor binding protein, glycoprotein, attachment protein, viral protein; VIRAL PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	32.84 Å
rg_electron	31.88 Å
i0	224285000.00
molecular_weight	122160.0 kDa
excluded_volume	153600 Å³
envelope_volume	189080 Å³
shell_volume	48000 Å³
envelope_diameter	116.7 Å
shell_rg	40.08 Å
envelope_rg	31.97 Å
shape_rg	31.84 Å
total_rg	32.68 Å
total_atoms	8592
n_residues	1077
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	105.0 Å
rg_real	32.74 Å
rg_real_error	0.66 Å
i0_real	2.2430e+08
i0_real_error	3.4300e+06
rg_reciprocal	32.79 Å
i0_reciprocal	224300000.0000
total_estimate	0.9000
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	2
r_peak_primary	37.2 Å
skewness	0.255
kurtosis	-0.511
angular_range	— – 0.2400 Å⁻¹
current_alpha	0.0000
highest_alpha	45610000.0000
n_real_points	49
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.914; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.955

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	Attachment glycoprotein
formula_weight	60535.9 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	B,A
atom_count	8592

THSRYFEEVNLDSISECSGPDMHLGLGVNPEFIEFPSFAPGSTKPGSCVRLPSFSLSTTVFAYTHTIMGHGCSELDVGDHYFSVGRIADAGHEIPQFETISSWFINDKINRRSCTVAAGAMEAWMGCVIMTETFYDDRNSLDTGKLTISYLDVFGRKKEWIYTRSEILYDYTYTSVYFSVGSGVVVGDTVYFLIWGSLSSPIEETAYCFAPDCSNYNQRMCNEAQRPSKFGHRQMVNGILKFKTTSTGKPLLSVGTLSPSVVPFGSEGRLMYSEITKIIYLYLRSTSWHALPLTGLFVLGPPTSISWIVQRAVSRPGEFPCGASNRCPKDCVTGVYTDLFPLGSRYEYAATVYLNSETYRVNPTLALINQTNIIASKKVTTESQRAGYTTTTCFVFKLRVWCISVVELAPSTMTAYEPIPFLYQLDLTCKGKNGSLAMRFAGKEGTYKSGRYKSPRNECFFEKVSNKYYFIVSTPEGIQPYEIRDLTPDRMPHIIMYISDVCAPALSAFKKLLPAMRPITTLTIGNWQFRPVEVSGGLRVN

Source

organism	Jeilongvirus beilongi
ncbi_taxonomy_id	3052263
host_organism	Homo

Entity 2 branched

description	;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
formula_weight	910.8 kDa
src_method	man
entity_count	1

Entity 3 non-polymer

description	2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	221.2 kDa
src_method	syn
entity_count	3

Entity 4 non-polymer

description	beta-D-mannopyranose
formula_weight	180.2 kDa
src_method	syn
entity_count	1

Entity 5 non-polymer

description	alpha-D-mannopyranose
formula_weight	180.2 kDa
src_method	syn
entity_count	1

▶

6. Citations (1)

▶

length_a	87.980 Å
length_b	162.380 Å
length_c	226.070 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	16

space_group	C 2 2 21
int_tables_number	20
crystal_system	orthorhombic

resolution	3.500 Å
resolution_low	55.230 Å
r_factor	0.2474
r_work	0.2461
r_free	0.2732

fit	/app/data/saxs_computation/qd/9qd0/9qd0.fit
pddf	/app/data/pr_computation/qd/9qd0/9qd0.pr.out
profile	/app/data/saxs_computation/qd/9qd0/9qd0.dat