← Back to search

9qf7

PRMT2 in complex with aDMA analog

Method: X-RAY DIFFRACTION D_max: 79.5 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9qf7
deposition_date	2025-03-11
last_revision	2026-03-25
title	PRMT2 in complex with aDMA analog
keywords	protein arginine N-methyltransferase, PRMT, PRMT2, transition state mimics, transcription, TRANSFERASE; TRANSFERASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	22.92 Å
rg_electron	22.10 Å
i0	25093400.00
molecular_weight	39261.0 kDa
excluded_volume	49458 Å³
envelope_volume	57891 Å³
shell_volume	22520 Å³
envelope_diameter	81.0 Å
shell_rg	28.27 Å
envelope_rg	22.57 Å
shape_rg	22.09 Å
total_rg	22.90 Å
total_atoms	5474
n_residues	339
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	79.5 Å
rg_real	22.97 Å
rg_real_error	0.59 Å
i0_real	2.5090e+07
i0_real_error	3.7790e+05
rg_reciprocal	22.96 Å
i0_reciprocal	25090000.0000
total_estimate	0.8561
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	25.7 Å
skewness	0.470
kurtosis	-0.159
angular_range	— – 0.3450 Å⁻¹
current_alpha	0.0000
highest_alpha	5275000.0000
n_real_points	66
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.744; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.947; Smooth: 0.945

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Protein arginine N-methyltransferase 2
formula_weight	50745.4 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	5523

GHMEAPGEGPCSESQVIPVLEEDPVDYGCEMQLLQDGAQLQLQLQPEEFVAIADYTATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHLGKQLEEYDPEDTWQDEEYFDSYGTLKLHLEMLADQPRTTKYHSVILQNKESLKDKVILDVGCGTGIISLFCAHHARPKAVYAVEASDMAQHTSQLVLQNGFADTITVFQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDTWLKGDGIIWPTTAALHLVPCSAEKDYHSKVLFWDNAYEFNLSALKSLAIKEFFSRPKSNHILKPEDCLSEPCTILQLDMRTVQVPDLETMRGELRFDIQKAGTLHGFTAWFSVYFQSLEEGQPQQVLSTGPLHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVSLSWVVTSALDPTSQRVGEKVFPIWR

Source

organism	Mus musculus
common_name	house mouse
ncbi_taxonomy_id	10090
host_organism	Spodoptera aff. frugiperda 1 BOLD-2017

Entity 2 non-polymer

description	;(phenylmethyl) (2S)-5-[[N-[3-[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]propyl]-N-methyl-carbamimidoyl]amino]-2-(phenylmethoxycarbonylamino)pentanoate ;
formula_weight	689.8 kDa
src_method	syn
entity_count	1

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	49

▶

6. Citations (1)

▶

length_a	65.727 Å
length_b	114.561 Å
length_c	132.721 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	C 2 2 21
int_tables_number	20
crystal_system	—

resolution	2.270 Å
resolution_low	29.560 Å
r_factor	0.1941
r_work	0.1920
r_free	0.2337

fit	/app/data/saxs_computation/qf/9qf7/9qf7.fit
pddf	/app/data/pr_computation/qf/9qf7/9qf7.pr.out
profile	/app/data/saxs_computation/qf/9qf7/9qf7.dat

PRMT2 in complex with aDMA analog

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction