SAXSdb — 9qjz

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Poly [ADP-ribose] polymerase tankyrase-2

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Mediator of DNA damage checkpoint protein 1 × 1 （Q14676） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Mediator of DNA damage checkpoint protein 1 × 1 （Q14676） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TNKS2_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 6–167； UniProt 488–649 Author chain B； PDBConstruct 6–167； UniProt 488–649

Mediator of DNA damage checkpoint protein 1

OrganismNot specified

UniProt Q14676

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Poly [ADP-ribose] polymerase tankyrase-2 × 1 （Q9H2K2） water × 2	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 2	Poly [ADP-ribose] polymerase tankyrase-2 × 1 （Q9H2K2） water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MDC1_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–16； UniProt 943–958 Author chain D； PDBConstruct 1–16； UniProt 943–958

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9qjz
Deposition date deposition_date	2025-03-19
Last revision last_revision	2025-11-05
Structure title title	Crystal structure of ARC4 from human Tankyrase 2 in complex with phosphorylated peptide from human MDC1
Keywords keywords	;ANKYRIN REPEAT, PROTEIN-PROTEIN INTERACTION, SUBSTRATE RECRUITMENT, POLY(ADP-RIBOSYL)ATION, SIGNALING PROTEIN-PEPTIDE COMPLEX, SIGNALING PROTEIN ;; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9qjz__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9qjz__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9qjz__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.58 Å
Rg (electron density)	15.71 Å
Total Rg	16.72 Å
Atom count	1228
Residues	164
Excluded volume	21698 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9qjz__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9qjz__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Poly [ADP-ribose] polymerase tankyrase-2
Molecular weight formula_weight	17995.3 kDa
EC 编号 ec_number	2.4.2.30,2.4.2.-
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2587

GAMGSGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVVEYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAKGKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAAL

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Mediator of DNA damage checkpoint protein 1
Molecular weight formula_weight	1870.7 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

ERDTQRGEPEGGSQDQ

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	57

▶

Unit-cell length a length_a	118.957 Å
Unit-cell length b length_b	118.957 Å
Unit-cell length c length_c	48.322 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 65
Space-group number int_tables_number	170
Crystal system crystal_system	—

Resolution resolution	2.310 Å
Low-resolution limit resolution_low	29.740 Å
R factor r_factor	0.1871
R_work r_work	0.1850
R_free r_free	0.2250

Crystal structure of ARC4 from human Tankyrase 2 in complex with phosphorylated peptide from human MDC1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Poly [ADP-ribose] polymerase tankyrase-2

State in the Current Structure

Other States of the Same Protein in the Database

Mediator of DNA damage checkpoint protein 1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9qjz__assembly_2__model_1

9qjz__assembly_2__model_1 | I(q)

9qjz__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)

Crystal structure of ARC4 from human Tankyrase 2 in complex with phosphorylated peptide from human MDC1

1. Protein Identity and Related Structures Protein Identity & Related Structures

Poly [ADP-ribose] polymerase tankyrase-2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Mediator of DNA damage checkpoint protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9qjz__assembly_2__model_1

9qjz__assembly_2__model_1 | I(q)

9qjz__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

7. Citations (1)