← Back to search

9qmf

Pseudomonas putida 4-hydroxyphenylpyruvate dioxygenase in complex with Tembotrione (Mn)

Method: X-RAY DIFFRACTION D_max: 119.7 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9qmf
deposition_date	2025-03-23
last_revision	2026-04-08
title	Pseudomonas putida 4-hydroxyphenylpyruvate dioxygenase in complex with Tembotrione (Mn)
keywords	;Dioxygenase, Phenylalanine catabolism, Tyrosine catabolism, Iron, Metal-binding, 4-hydroxyphenylpyruvate, homogentisic acid, OXIDOREDUCTASE ;; OXIDOREDUCTASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	38.60 Å
rg_electron	37.81 Å
i0	666337000.00
molecular_weight	141720.0 kDa
excluded_volume	137670 Å³
envelope_volume	257480 Å³
shell_volume	55068 Å³
envelope_diameter	122.6 Å
shell_rg	45.99 Å
envelope_rg	36.52 Å
shape_rg	37.81 Å
total_rg	38.17 Å
total_atoms	10722
n_residues	1334
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	119.7 Å
rg_real	38.35 Å
rg_real_error	0.81 Å
i0_real	6.6630e+08
i0_real_error	1.0640e+07
rg_reciprocal	38.51 Å
i0_reciprocal	666400000.0000
total_estimate	0.9052
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	0
r_peak_primary	— Å
skewness	0.027
kurtosis	-0.693
angular_range	— – 0.2050 Å⁻¹
current_alpha	0.0000
highest_alpha	63030000.0000
n_real_points	42
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.934; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.995; Smooth: 0.968

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	4-hydroxyphenylpyruvate dioxygenase
formula_weight	40473.9 kDa
ec_number	1.13.11.27
src_method	man
entity_count	4

Polymer

type	polypeptide(L)
strand_id	A,B,C,D
atom_count	12055

GGSSADIFDNPMGLMGFEFIELASPTPGVLEPVFQMLGFTKVATHRSKDVHLYRQGDINLILNNEPKSIASYFAAEHGPSVCGMAFRVRNAHEAYARALELGAQPVEIETGPMELRLPAIKGIGGAPLYLIDRFEEGSSIYDIDFKFIEGVDRNPVGAGLKIIDHLTHNVYRGRMSYWAGFYEKLFNFREIRYFDIKGEYTGLTSRAMTAPDGMIRIPLNEESSKGSGQIEEFLMQFNGEGIQHVAFLTDDLLKTWDALKGFGMRFMTAPPQTYYEMLEERLPGHGEPVDQLKARGILLDGASQPDDKRLLLQIFSETLLGPVFFEFIQRKGDDGFGEGNFKALFESIERDQVRRGVLSTD

Source

organism	Pseudomonas putida
ncbi_taxonomy_id	303
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	MANGANESE (II) ION
formula_weight	54.9 kDa
src_method	syn
entity_count	4

Entity 3 non-polymer

description	Tembotrione
formula_weight	440.8 kDa
src_method	nat
entity_count	4

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	1154

▶

6. Citations (1)

▶

length_a	152.014 Å
length_b	168.364 Å
length_c	81.810 Å
angle_alpha	90.00 °
angle_beta	91.98 °
angle_gamma	90.00 °
z_pdb	16

space_group	C 1 2 1
int_tables_number	5
crystal_system	—

resolution	1.950 Å
resolution_low	52.640 Å
r_factor	0.2115
r_work	0.2097
r_free	0.2447

fit	/app/data/saxs_computation/qm/9qmf/9qmf.fit
pddf	/app/data/pr_computation/qm/9qmf/9qmf.pr.out
profile	/app/data/saxs_computation/qm/9qmf/9qmf.dat

Pseudomonas putida 4-hydroxyphenylpyruvate dioxygenase in complex with Tembotrione (Mn)

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction