SAXSdb — 9qww

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

NRC2a

Nicotiana benthamiana

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Truncated secreted SPRY domain-containing protein 15 × 2 （A0A024E1S8）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0S3ANR1_NICBE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–886； UniProt 1–886 Author chain C； PDBConstruct 1–886； UniProt 1–886

Truncated secreted SPRY domain-containing protein 15

Globodera rostochiensis

UniProt A0A024E1S8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	NRC2a × 2 （A0A0S3ANR1）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A024E1S8_GLORO
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 3–224； UniProt 1–222 Author chain D； PDBConstruct 3–224； UniProt 1–222

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9qww
Deposition date deposition_date	2025-04-15
Structure title title	Cryo-EM structure of plant resistance protein NRC2 dimer bound to nematode effector SPRYSEC-15
Keywords keywords	Helper resistance protein, Plant immunity, Suppressor, PLANT PROTEIN; PLANT PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9qww__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9qww__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9qww__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	45.68 Å
Rg (electron density)	45.49 Å
Total Rg	45.54 Å
Atom count	14400
Residues	1834
Excluded volume	257680 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9qww__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	NRC2a
Molecular weight formula_weight	101270.0 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	14400

MANVAVEFLVQNLMQLLRDNAELIVGVKDSAESLLQDLNDFNAFLKQTAKSRTENDVHKELVKKIKTVVNSAEDAIDKFVIEAKLHKDKGVGRFVDVKHYKRVYDVAGEIKTIRDKVKEIRLNNALDLQALQDEDQSAKGVQERKPPVVEEDDVVGFEEEADKVINRLLGGSSGLEVVPVVGMPGLGKTTLANKIYKHPDIGYQFFTRIWVYVSQSYRRRELFLNIISKFTRNTKQYHDMCEEDLADEIEDFLGKGGKYLIVLDDVWSPDAWERIRIAFPNNNKSNRILLTTRDSKVAKQCKQCIGIPHDLKFLTEDESWILLEKKVFHKDKCPPELELSGKSIAKKCNGLPLAIVVIAGALIGKGKTSREWKQVDESVGEHLINKDQPENCNKLVQLSYDRLSYDLKACFLYCGAFPGGFEIPAWKLIRLWIAEGFIQYKGHLSLECKAEDNLNDLINRNLVMVMQRTSDGQIKTCRLHDMLHEFCRQEAMKEENLFQEIKLGAEQYFPGKRELATYRRLCIHSSVLEFISTKPSGEHVRSFLSFSLKKIEMPSVDIPTIPKGFPLLRVFDVESINFSRFSKEFFQLYHLRYIAFSSDTIKIIPKHIGELWNIQTLIINTQQRSLDIQANIWNMERLRHLHTNSSAKLPVPVTPRSSKVPLVNQSLQTLSTIAPESCTEEVFARTPNLKKLGIRGKIAVLLEPNKSLLKNVKKLESLENLKLINDSSQTGKGLRLPPSYIFPTKLRKLSLVDTWLEWNDMSILGQMEHLEVLKLKENGFMGECWESVGGFCSLLVLWIERTDLVSWKASADHFPRLKHLVLICCDKLKEIPIGLADIRSFQVMELQNSTKTAAISARGIRDKKDKQTQEGTNNNGFKLSIFPPDL

Source Source

Source organism organism	Nicotiana benthamiana
NCBI taxonomy ID ncbi_taxonomy_id	4100
Host organism host_organism	Nicotiana benthamiana

Entity 2 Entity 2 polymer

Description description	Truncated secreted SPRY domain-containing protein 15
Molecular weight formula_weight	25402.2 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

GPSPKANAKLEKVPSGNAESTPVLTLQNRWAYSARDEKLAWDSAARDEKLELTEPAGLIVQFIGENSKHRSVRAKLPIPKGNSGIFYYEVTISGDGDAIYIGLATEQMPLRDTHVGYNEGTYGYGSSGKFWGHEVGGCSHWGNERPYIDGQPKFDRNNIIGCGVNLKTRQIIYTHNGRPLETTGLLVAESAAELYPCVSLFTSGNEIEANFGTKPFKFNIAEGIDDVVGFEE

Source Source

Source organism organism	Globodera rostochiensis
NCBI taxonomy ID ncbi_taxonomy_id	31243
Host organism host_organism	Nicotiana benthamiana

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	102500

Cryo-EM structure of plant resistance protein NRC2 dimer bound to nematode effector SPRYSEC-15

1. Protein Identity and Related Structures Protein Identity & Related Structures

NRC2a

State in the Current Structure

Other States of the Same Protein in the Database

Truncated secreted SPRY domain-containing protein 15

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9qww__assembly_1__model_1

9qww__assembly_1__model_1 | I(q)

9qww__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)

Cryo-EM structure of plant resistance protein NRC2 dimer bound to nematode effector SPRYSEC-15

1. Protein Identity and Related Structures Protein Identity & Related Structures

NRC2a

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Truncated secreted SPRY domain-containing protein 15

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9qww__assembly_1__model_1

9qww__assembly_1__model_1 | I(q)

9qww__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

7. Citations (1)