← Back to search

9r97

DhhP of Borrelia burgdorferi in complex with AMP (SAD/Mn)

Method: X-RAY DIFFRACTION D_max: 191.2 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9r97
deposition_date	2025-05-19
title	DhhP of Borrelia burgdorferi in complex with AMP (SAD/Mn)
keywords	phosphodiesterase, c-di-AMP, cyclic di-AMP, heterobimetallic, HYDROLASE; HYDROLASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	54.27 Å
rg_electron	54.43 Å
i0	1130910000.00
molecular_weight	292230.0 kDa
excluded_volume	370130 Å³
envelope_volume	530290 Å³
shell_volume	85542 Å³
envelope_diameter	200.4 Å
shell_rg	53.92 Å
envelope_rg	52.56 Å
shape_rg	54.44 Å
total_rg	54.38 Å
total_atoms	20539
n_residues	2574
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	191.2 Å
rg_real	54.40 Å
rg_real_error	2.15 Å
i0_real	1.1310e+09
i0_real_error	2.3580e+07
rg_reciprocal	54.15 Å
i0_reciprocal	1130000000.0000
total_estimate	0.8577
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	65.9 Å
skewness	0.422
kurtosis	-0.098
angular_range	— – 0.1450 Å⁻¹
current_alpha	0.0000
highest_alpha	51310000.0000
n_real_points	30
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.807; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.727

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	DHH family
formula_weight	36659.1 kDa
src_method	man
entity_count	8

Polymer

type	polypeptide(L)
strand_id	A,B,C,D,E,F,G,H
atom_count	20549

GAMGSMRDVINFIKKYNNFVIIGHKDPDFDCIGSSLALSSFLSRIGKNSILLNEGPFIRKEIVPFKDKFLSEWPNIEISEYSVIILDCSILDRIGDEFIFYVKNMPTLVIDHHMSGEKLECEGYIDPFAPSTTFLIEKLIREFGYDLTKEEAWYILVGFCTDTGFFKFISRSDPEPFEMVARLVSKGISLKEVYSYIETTKSLKSIETLKLMLNSLESYWNGKVLFTFLSSSSSGKDGGVSGVNELFYMILSNVENNEILGILKEMEDGSIIVGLRSKDSFDVGKLAEDFGGGGHKNASGFRIKQGSLEIVKNRMLAYIKDNIYL

Source

organism	Borreliella burgdorferi
common_name	Lyme disease spirochete
ncbi_taxonomy_id	139
host_organism	Escherichia coli BL21(DE3)

Entity 2 non-polymer

description	MANGANESE (II) ION
formula_weight	54.9 kDa
src_method	syn
entity_count	8

Entity 3 non-polymer

description	FE (III) ION
formula_weight	55.8 kDa
src_method	syn
entity_count	8

Entity 4 non-polymer

description	ADENOSINE MONOPHOSPHATE
formula_weight	347.2 kDa
src_method	syn
entity_count	4

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	10

▶

6. Citations (1)

▶

length_a	74.760 Å
length_b	80.350 Å
length_c	132.860 Å
angle_alpha	91.15 °
angle_beta	91.28 °
angle_gamma	92.70 °
z_pdb	8

space_group	P 1
int_tables_number	1
crystal_system	triclinic

resolution	3.300 Å
resolution_low	49.050 Å
r_factor	0.1690
r_work	0.1671
r_free	0.2041

fit	/app/data/saxs_computation/r9/9r97/9r97.fit
pddf	/app/data/pr_computation/r9/9r97/9r97.pr.out
profile	/app/data/saxs_computation/r9/9r97/9r97.dat