← Back to search

9r9j

IRAK4 in complex with inhibitor

Method: X-RAY DIFFRACTION D_max: 110.9 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9r9j
deposition_date	2025-05-20
last_revision	2025-10-01
title	IRAK4 in complex with inhibitor
keywords	inhibitor complex phosphorylation signal transduction, TRANSFERASE; TRANSFERASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	33.58 Å
rg_electron	32.87 Å
i0	520609000.00
molecular_weight	121280.0 kDa
excluded_volume	116390 Å³
envelope_volume	209530 Å³
shell_volume	51709 Å³
envelope_diameter	116.5 Å
shell_rg	40.74 Å
envelope_rg	32.86 Å
shape_rg	32.84 Å
total_rg	33.34 Å
total_atoms	9141
n_residues	1133
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	110.9 Å
rg_real	33.50 Å
rg_real_error	0.70 Å
i0_real	5.2060e+08
i0_real_error	8.5790e+06
rg_reciprocal	33.55 Å
i0_reciprocal	520600000.0000
total_estimate	0.8830
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	42.5 Å
skewness	0.294
kurtosis	-0.248
angular_range	— – 0.2350 Å⁻¹
current_alpha	0.0001
highest_alpha	55830000.0000
n_real_points	48
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.840; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.955

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Interleukin-1 receptor-associated kinase 4
formula_weight	34635.0 kDa
ec_number	2.7.11.1
src_method	man
entity_count	4

Polymer

type	polypeptide(L)
strand_id	A,B,C,D
atom_count	9583

GENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTAS

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Spodoptera frugiperda

Entity 2 non-polymer

description	~{N}-[2-(3-methyl-3-oxidanyl-butyl)-6-(2-oxidanylpropan-2-yl)indazol-5-yl]-1-(2-methylpyridin-4-yl)pyrazole-3-carboxamide
formula_weight	462.5 kDa
src_method	syn
entity_count	4

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	442

▶

6. Citations (1)

▶

length_a	143.290 Å
length_b	140.240 Å
length_c	88.800 Å
angle_alpha	90.00 °
angle_beta	124.06 °
angle_gamma	90.00 °
z_pdb	16

space_group	C 1 2 1
int_tables_number	5
crystal_system	—

resolution	2.390 Å
resolution_low	90.000 Å
r_factor	0.2230
r_work	0.2210
r_free	0.2630

fit	/app/data/saxs_computation/r9/9r9j/9r9j.fit
pddf	/app/data/pr_computation/r9/9r9j/9r9j.pr.out
profile	/app/data/saxs_computation/r9/9r9j/9r9j.dat

IRAK4 in complex with inhibitor

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction