← Back to search

9rf0

Structure of PcuC from Cereibacter sphaeroides in its copper bound form

Method: X-RAY DIFFRACTION D_max: 50.3 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9rf0
deposition_date	2025-06-04
last_revision	2026-05-06
title	Structure of PcuC from Cereibacter sphaeroides in its copper bound form
keywords	PcuC, copper, chaperone; CHAPERONE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	15.45 Å
rg_electron	14.22 Å
i0	3453000.00
molecular_weight	12501.0 kDa
excluded_volume	15361 Å³
envelope_volume	17657 Å³
shell_volume	11033 Å³
envelope_diameter	49.1 Å
shell_rg	19.37 Å
envelope_rg	14.70 Å
shape_rg	14.24 Å
total_rg	15.20 Å
total_atoms	870
n_residues	119
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	50.3 Å
rg_real	15.41 Å
rg_real_error	0.29 Å
i0_real	3.4530e+06
i0_real_error	3.5540e+04
rg_reciprocal	15.42 Å
i0_reciprocal	3453000.0000
total_estimate	0.8955
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	18.5 Å
skewness	0.246
kurtosis	-0.343
angular_range	— – 0.5000 Å⁻¹
current_alpha	0.0000
highest_alpha	392800.0000
n_real_points	80
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.885; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.997; Smooth: 0.986

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (4)

Entity 1 polymer

description	Copper chaperone PCu(A)C
formula_weight	16790.7 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	901

MGSSHHHHHHSSGENLYFQGDSELAVTDAYARVASPAAQSGAIFMVIENHGASDDRLVSAATDAAARVELHTHLAGQDGVMQMVEVKEGFPVPAHGSHALARGGDHVMLMGLTKPLKEGDEIALTLTFESGKVLEVAAPVDTSREAPMGDHMKGMTHGN

Source

organism	Cereibacter sphaeroides
ncbi_taxonomy_id	1063
host_organism	Escherichia coli

Entity 2 non-polymer

description	COPPER (II) ION
formula_weight	63.5 kDa
src_method	syn
entity_count	2

Entity 3 non-polymer

description	CITRATE ANION
formula_weight	189.1 kDa
src_method	syn
entity_count	1

Entity 4 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	25

▶

6. Citations (1)

▶

length_a	55.660 Å
length_b	55.660 Å
length_c	81.920 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	P 41 21 2
int_tables_number	92
crystal_system	—

resolution	2.743 Å
resolution_low	46.040 Å
r_factor	0.2484
r_work	0.2458
r_free	0.2937

fit	/app/data/saxs_computation/rf/9rf0/9rf0.fit
pddf	/app/data/pr_computation/rf/9rf0/9rf0.pr.out
profile	/app/data/saxs_computation/rf/9rf0/9rf0.dat

Structure of PcuC from Cereibacter sphaeroides in its copper bound form

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction