SAXSdb — 9rk4

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Similar to the Rieske Protein II of bc1 complex

Candidatus Kuenenia sp.

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 12	FE2/S2 (INORGANIC) CLUSTER × 12 SULFATE ION × 12	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q1Q5P2_KUEST
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–110； UniProt 64–173 Author chain B； PDBConstruct 1–110； UniProt 64–173 Author chain C； PDBConstruct 1–110； UniProt 64–173 Author chain D； PDBConstruct 1–110； UniProt 64–173 Author chain E； PDBConstruct 1–110； UniProt 64–173 Author chain F； PDBConstruct 1–110； UniProt 64–173 Author chain G； PDBConstruct 1–110； UniProt 64–173 Author chain H； PDBConstruct 1–110； UniProt 64–173 Author chain I； PDBConstruct 1–110； UniProt 64–173 Author chain J； PDBConstruct 1–110； UniProt 64–173 Author chain K； PDBConstruct 1–110； UniProt 64–173 Author chain L； PDBConstruct 1–110； UniProt 64–173

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9rk4
Deposition date deposition_date	2025-06-12
Structure title title	Soluble domain of kuste4569, a Rieske iron-sulfur cluster protein from Kuenenia stuttgartiensis
Keywords keywords	Rieske, anammox, anaerobic ammonium oxidation, ensemble refinement, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9rk4__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9rk4__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9rk4__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	37.35 Å
Rg (electron density)	36.98 Å
Total Rg	37.45 Å
Atom count	10368
Residues	1320
Excluded volume	186430 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9rk4__assembly_1__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Similar to the Rieske Protein II of bc1 complex
Molecular weight formula_weight	12170.1 kDa
EC 编号 ec_number	1.10.99.1
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F,G,H,I,J,K,L
Atom count atom_count	10368

SPRFFVGEPKQFPVGSVTTLKSRKIFVVRDADSFKAISVVCTHLGCAVEFSKEKNIFECPCHGSKYYRNGVNFAGPAPRPLDHLQMILDNNGKLAVDTSVKVPLETELIV

Source Source

Source organism organism	Candidatus Kuenenia sp.
NCBI taxonomy ID ncbi_taxonomy_id	2499824
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	12

Entity 3 Entity 3 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	12

▶

Unit-cell length a length_a	103.961 Å
Unit-cell length b length_b	120.730 Å
Unit-cell length c length_c	209.245 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	73.740 Å
R factor r_factor	0.2661
R_work r_work	0.2645
R_free r_free	0.2972

Soluble domain of kuste4569, a Rieske iron-sulfur cluster protein from Kuenenia stuttgartiensis

1. Protein Identity and Related Structures Protein Identity & Related Structures

Similar to the Rieske Protein II of bc1 complex

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9rk4__assembly_1__model_1

9rk4__assembly_1__model_1 | I(q)

9rk4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

7. Citations (1)

Soluble domain of kuste4569, a Rieske iron-sulfur cluster protein from Kuenenia stuttgartiensis

1. Protein Identity and Related Structures Protein Identity & Related Structures

Similar to the Rieske Protein II of bc1 complex

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9rk4__assembly_1__model_1

9rk4__assembly_1__model_1 | I(q)

9rk4__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

7. Citations (1)