SAXSdb — 9scw

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein VP1

Coxsackievirus B1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 240	MYRISTIC ACID × 24	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 180	No other associated polymer	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	POLG_CXB1J
Isoform	—
PDB entities	1, 2, 3, 4
Chains and sequence ranges	Author chain 0； PDBConstruct 1–263； UniProt 571–848 Author chain 1； PDBConstruct 1–263； UniProt 571–848 Author chain 8； PDBConstruct 1–263； UniProt 571–848 Author chain A； PDBConstruct 1–263； UniProt 571–848 Author chain AC； PDBConstruct 1–263； UniProt 571–848 Author chain AG； PDBConstruct 1–263； UniProt 571–848 Author chain AK； PDBConstruct 1–263； UniProt 571–848 Author chain AO； PDBConstruct 1–263； UniProt 571–848 Author chain E； PDBConstruct 1–263； UniProt 571–848 Author chain I； PDBConstruct 1–263； UniProt 571–848 Author chain M； PDBConstruct 1–263； UniProt 571–848 Author chain Q； PDBConstruct 1–263； UniProt 571–848 Author chain U； PDBConstruct 1–263； UniProt 571–848 Author chain Y； PDBConstruct 1–263； UniProt 571–848 Author chain c； PDBConstruct 1–263； UniProt 571–848 Author chain g； PDBConstruct 1–263； UniProt 571–848 Author chain k； PDBConstruct 1–263； UniProt 571–848 Author chain o； PDBConstruct 1–263； UniProt 571–848 Author chain s； PDBConstruct 1–263； UniProt 571–848 Author chain w； PDBConstruct 1–263； UniProt 571–848 Author chain 2； PDBConstruct 1–263； UniProt 70–332 Author chain 5； PDBConstruct 1–263； UniProt 70–332 Author chain 9； PDBConstruct 1–263； UniProt 70–332 Author chain AD； PDBConstruct 1–263； UniProt 70–332 Author chain AH； PDBConstruct 1–263； UniProt 70–332 Author chain AL； PDBConstruct 1–263； UniProt 70–332 Author chain AP； PDBConstruct 1–263； UniProt 70–332 Author chain B； PDBConstruct 1–263； UniProt 70–332 Author chain F； PDBConstruct 1–263； UniProt 70–332 Author chain J； PDBConstruct 1–263； UniProt 70–332 Author chain N； PDBConstruct 1–263； UniProt 70–332 Author chain R； PDBConstruct 1–263； UniProt 70–332 Author chain V； PDBConstruct 1–263； UniProt 70–332 Author chain Z； PDBConstruct 1–263； UniProt 70–332 Author chain d； PDBConstruct 1–263； UniProt 70–332 Author chain h； PDBConstruct 1–263； UniProt 70–332 Author chain l； PDBConstruct 1–263； UniProt 70–332 Author chain p； PDBConstruct 1–263； UniProt 70–332 Author chain t； PDBConstruct 1–263； UniProt 70–332 Author chain x； PDBConstruct 1–263； UniProt 70–332 Author chain 3； PDBConstruct 1–238； UniProt 333–570 Author chain 6； PDBConstruct 1–238； UniProt 333–570 Author chain AA； PDBConstruct 1–238； UniProt 333–570 Author chain AE； PDBConstruct 1–238； UniProt 333–570 Author chain AI； PDBConstruct 1–238； UniProt 333–570 Author chain AM； PDBConstruct 1–238； UniProt 333–570 Author chain AQ； PDBConstruct 1–238； UniProt 333–570 Author chain C； PDBConstruct 1–238； UniProt 333–570 Author chain G； PDBConstruct 1–238； UniProt 333–570 Author chain K； PDBConstruct 1–238； UniProt 333–570 Author chain O； PDBConstruct 1–238； UniProt 333–570 Author chain S； PDBConstruct 1–238； UniProt 333–570 Author chain W； PDBConstruct 1–238； UniProt 333–570 Author chain a； PDBConstruct 1–238； UniProt 333–570 Author chain e； PDBConstruct 1–238； UniProt 333–570 Author chain i； PDBConstruct 1–238； UniProt 333–570 Author chain m； PDBConstruct 1–238； UniProt 333–570 Author chain q； PDBConstruct 1–238； UniProt 333–570 Author chain u； PDBConstruct 1–238； UniProt 333–570 Author chain y； PDBConstruct 1–238； UniProt 333–570 Author chain 4； PDBConstruct 1–69； UniProt 1–69 Author chain D； PDBConstruct 1–69； UniProt 1–69 Author chain H； PDBConstruct 1–69； UniProt 1–69 Author chain L； PDBConstruct 1–69； UniProt 1–69 Author chain P； PDBConstruct 1–69； UniProt 1–69 Author chain T； PDBConstruct 1–69； UniProt 1–69 Author chain X； PDBConstruct 1–69； UniProt 1–69 Author chain b； PDBConstruct 1–69； UniProt 1–69 Author chain f； PDBConstruct 1–69； UniProt 1–69 Author chain j； PDBConstruct 1–69； UniProt 1–69

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9scw
Deposition date deposition_date	2025-08-12
Last revision last_revision	2025-10-08
Structure title title	Crystal structure of Coxsackie B1 virus-like particle delta-palxa
Keywords keywords	coxsackievirus B1, VIRUS-LIKE PARTICLE, VIRUS LIKE PARTICLE; VIRUS LIKE PARTICLE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9scw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9scw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9scw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	133.70 Å
Total Rg	133.70 Å
Atom count	664668
Residues	43614
Excluded volume	6009100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9scw__assembly_1__model_1`	240-meric （240）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9scw__assembly_2__model_1`	180-meric （180）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Capsid protein VP1
Molecular weight formula_weight	29729.5 kDa
Source method src_method	man
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1,A,E,Y,g,I,M,Q,U,c,k,o,s,w,0,8,AC,AG,AK,AO
Atom count atom_count	211656

GPVEESVERAMVRVADTVSSRPTNSQVVPSDTMQTRHVKNYHSRSESSIENFLCRAACVYYATYTNNSEKGYAEWVINTRQVAQLRRKLELFTYLRFDLELTFVITSAQQPSTATSVDAPVQTHQIMYVPPGGPVPTKVTDYAWQTSTNPSVFWTEGNAPPRMSIPFISIGNAYSCFYDGWTQFSRNGVYGINTLNNMGTLYMRHVNEAGQGPIKSTVRIYFKPKHVKAWVPRPPRLCQYEKQKNVNFTPTGVTTTRVGITTT

Source Source

Source organism organism	Coxsackievirus B1
NCBI taxonomy ID ncbi_taxonomy_id	12071
Host organism host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	Capsid protein VP2
Molecular weight formula_weight	29137.8 kDa
Source method src_method	man
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2,B,F,Z,h,J,N,R,V,d,l,p,t,x,5,9,AD,AH,AL,AP

SPSAEECGFSDRVRSITLGNSTITTQECANVVVGYGVWPEYLKDNEATAEDQPTQPDVATCRFYTLESVQWMKNSAGWWWKLPDALSQMGLFGQNMQYHYLGRTGYTIHVQCNASKFHQGCLLVVCVPEAEMGCSNLNNTPEFAELSGGDTARMFTDTQIGETNSKKVQTAVWNAGMGVGVGNLTIYPHQWINLRTNNSATIVMPYINSVPMDNMFRHNNLTLMIIPFVPLNYSEGSSPYVPITVTIAPMCAEYNGLRLASSQ

Source Source

Source organism organism	Coxsackievirus B1
NCBI taxonomy ID ncbi_taxonomy_id	12071
Host organism host_organism	Trichoplusia ni

Entity 3 Entity 3 polymer

Description description	Capsid protein VP3
Molecular weight formula_weight	26268.8 kDa
Source method src_method	man
Copy count entity_count	20

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3,C,G,a,i,K,O,S,W,e,m,q,u,y,6,AA,AE,AI,AM,AQ

GLPVMTTPGSTQFLTSDDFQSPSAMPQFDVTPEMQIPGRVNNLMEIAEVDSVVPVNNTEANVNSLKAYQIPVQSNSDNGKQVFGFPLQPGANGVLNRTLLGEILNYYTHWSGSIKLTFMFCGSAMATGKFLLAYSPPGAGVPKNRKDAMLGTHVIWDVGLQSSCVLCVPWISQTHYRYVVEDEYTAAGYITCWYQTNIVVPADVQSSCDILCFVSACNDFSVRMLKDTPFIRQDTFYQ

Source Source

Source organism organism	Coxsackievirus B1
NCBI taxonomy ID ncbi_taxonomy_id	12071
Host organism host_organism	Trichoplusia ni

Entity 4 Entity 4 polymer

Description description	Capsid protein VP4
Molecular weight formula_weight	7498.3 kDa
Source method src_method	man
Copy count entity_count	10

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4,D,H,b,j,L,P,T,X,f

MGAQVSTQKTGAHETGLNASGNSIIHYTNINYYKDAASNSANRQDFTQDPGKFTEPVKDIMIKSMPALN

Source Source

Source organism organism	Coxsackievirus B1
NCBI taxonomy ID ncbi_taxonomy_id	12071
Host organism host_organism	Trichoplusia ni

Entity 5 Entity 5 non-polymer

Description description	MYRISTIC ACID
Molecular weight formula_weight	228.4 kDa
Source method src_method	syn
Copy count entity_count	4

▶

Unit-cell length a length_a	343.999 Å
Unit-cell length b length_b	343.999 Å
Unit-cell length c length_c	457.065 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	120

Space group space_group	P 3 1 2
Space-group number int_tables_number	149
Crystal system crystal_system	trigonal

Resolution resolution	3.200 Å
Low-resolution limit resolution_low	97.040 Å
R factor r_factor	0.2941
R_work r_work	0.2932
R_free r_free	0.3097

Crystal structure of Coxsackie B1 virus-like particle delta-palxa

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein VP1

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9scw__assembly_1__model_1

9scw__assembly_1__model_1 | I(q)

9scw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

7. Citations (1)

Crystal structure of Coxsackie B1 virus-like particle delta-palxa

1. Protein Identity and Related Structures Protein Identity & Related Structures

Capsid protein VP1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9scw__assembly_1__model_1

9scw__assembly_1__model_1 | I(q)

9scw__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

7. Citations (1)