← Back to search

9sf2

Phage Phi106 repressor in complex with AimX

Method: X-RAY DIFFRACTION D_max: 61.3 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9sf2
deposition_date	2025-08-19
title	Phage Phi106 repressor in complex with AimX
keywords	Phage repressor, antirepressor, VIRAL PROTEIN; VIRAL PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	18.03 Å
rg_electron	16.90 Å
i0	6361370.00
molecular_weight	18135.0 kDa
excluded_volume	22660 Å³
envelope_volume	26899 Å³
shell_volume	13991 Å³
envelope_diameter	61.8 Å
shell_rg	22.05 Å
envelope_rg	17.07 Å
shape_rg	16.82 Å
total_rg	18.05 Å
total_atoms	2494
n_residues	151
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	61.3 Å
rg_real	18.00 Å
rg_real_error	0.37 Å
i0_real	6.3610e+06
i0_real_error	7.7560e+04
rg_reciprocal	18.01 Å
i0_reciprocal	6361000.0000
total_estimate	0.7931
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	19.1 Å
skewness	0.308
kurtosis	-0.314
angular_range	— – 0.4400 Å⁻¹
current_alpha	0.0000
highest_alpha	1266000.0000
n_real_points	75
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.771; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.993; Smooth: 0.000

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (7)

Entity 1 polymer

description	Transcriptional regulator
formula_weight	14855.8 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2615

MSNNTGVKLKKLRKSKKLTLRDLADKLGVTHSYLSKIERGVTNPSLKMINSLAEFFDVDQSYFFTDEKNLDNFTDEELELTFERDLSIENLREKYNLTLGGKEVSDDEIKVMLEVLKAYRESKGGSRSD

Source

organism	Bacillus
ncbi_taxonomy_id	1889774
host_organism	Escherichia coli

Entity 2 polymer

description	Bacillus phage phi106 antirepressor
formula_weight	3354.9 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

MKKEISLDEYLEKLKQLLENESVGTRAAL

Source

organism	Bacillaceae bacterium
ncbi_taxonomy_id	1889774
host_organism	Escherichia coli

Entity 3 non-polymer

description	ZINC ION
formula_weight	65.4 kDa
src_method	syn
entity_count	4

Entity 4 non-polymer

description	ACETATE ION
formula_weight	59.0 kDa
src_method	syn
entity_count	6

Entity 5 non-polymer

description	IMIDAZOLE
formula_weight	69.1 kDa
src_method	syn
entity_count	1

Entity 6 non-polymer

description	GLYCEROL
formula_weight	92.1 kDa
src_method	syn
entity_count	1

Entity 7 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	67

▶

6. Citations (1)

▶

length_a	56.991 Å
length_b	56.991 Å
length_c	100.716 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	8

space_group	P 43 21 2
int_tables_number	96
crystal_system	—

resolution	1.700 Å
resolution_low	49.601 Å
r_factor	—
r_work	0.1787
r_free	0.2187

fit	/app/data/saxs_computation/sf/9sf2/9sf2.fit
pddf	/app/data/pr_computation/sf/9sf2/9sf2.pr.out
profile	/app/data/saxs_computation/sf/9sf2/9sf2.dat

Phage Phi106 repressor in complex with AimX

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (7)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 non-polymer

Entity 4 non-polymer

Entity 5 non-polymer

Entity 6 non-polymer

Entity 7 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)