SAXSdb — 9shd

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Envelop protein OPG153

Orthopoxvirus vaccinia

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Heavy chain of Fab 10M2146 × 1 Light chain of Fab 10M2146 × 1 Anti-Fab VHH × 1 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PG153_VACCW
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain H0Z0； PDBConstruct 1–397； UniProt 1–397

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9shd
Deposition date deposition_date	2025-08-26
Last revision last_revision	2025-11-19
Structure title title	Structure of vaccinia virus A26 (residues 1-397) in complex with Fab 10M2146
Keywords keywords	complex antigen-antibody, vaccinia virus, A26, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9shd__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9shd__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9shd__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	36.70 Å
Rg (electron density)	36.43 Å
Total Rg	36.82 Å
Atom count	7148
Residues	907
Excluded volume	126750 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9shd__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	Heavy chain of Fab 10M2146
Molecular weight formula_weight	24551.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H
Atom count atom_count	8303

EVQLVQSGAEVKKPGESLKISCKGSGYSFTTHWIGWVRQMPGEGLEWLGIIYPGDSETKYSPSFQGQVTISVDKSINTAYLHWSSLKASDTAMYFCARRPKNYYDASGYYNWLDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 2 Entity 2 polymer

Description description	Light chain of Fab 10M2146
Molecular weight formula_weight	23410.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

EIQMTQSPSTLSASVGDRVTITCRASQSLSTWLAWYQQKPGKAPKLLIYKASILESGVPSRFSASGSGTEFTLTISGLQPDDFATYYCQQYNSYLGAFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Source Source

Source organism organism	Homo sapiens
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Homo sapiens

Entity 3 Entity 3 polymer

Description description	Anti-Fab VHH
Molecular weight formula_weight	13390.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

GSQVQLQESGGGLVQPGGSLRLSCAASGRTISRYAMSWFRQAPGKEREFVAVARRSGDGAFYADSVQGRFTVSRDDAKNTVYLQMNSLKPEDTAVYYCAIDSDTFYSGSYDYWGQGTQVTVSS

Source Source

Source organism organism	Lama glama
NCBI taxonomy ID ncbi_taxonomy_id	9844
Host organism host_organism	Escherichia coli

Entity 4 Entity 4 polymer

Description description	Envelop protein OPG153
Molecular weight formula_weight	52359.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H0Z0

MANIINLWNGIVPTVQDVNVASITAFKSMIDETWDKKIEANTCISRKHRNIIHEVIRDFMKAYPKMDENKKSPLGAPMQWLTQYYILKNEYHKTMLAYDNGSLNTKFKTLNIYMITNVGQYILYIVFCIISGKNHDGTPYIYDSEITSNDKNFINERIKYACKQILHGQLTIALRIRNKFMFIGSPMYLWFNVNGSQVYHDIYDRNAGFHNKEIGRLLYAFMYYLSISGRFLNDFALLKFTYLGESWTFSLSVPEYILYGLGYSVFDTIEKFSNDAILVYIRTNNRNGYDYVEFNKKGIAKVTEDKPDNDKRIHAIRLINDSTDVQHIHFGFRNMVIIDNECANIQSSAENATDTGHHQDSKINIEVEDDVIDDDDYNPKPTPIPEPHPRPPFPRHEGSGLVPRIGSGSAGWSHPQFEKGGGSGGGSGGGSWSHPQFEKGTGGLNDIFEAQKIEWHE

Source Source

Source organism organism	Orthopoxvirus vaccinia
NCBI taxonomy ID ncbi_taxonomy_id	10245
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	1067

▶

Unit-cell length a length_a	122.459 Å
Unit-cell length b length_b	157.821 Å
Unit-cell length c length_c	141.434 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	orthorhombic

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	39.930 Å
R factor r_factor	0.1593
R_work r_work	0.1577
R_free r_free	0.1903

Structure of vaccinia virus A26 (residues 1-397) in complex with Fab 10M2146

1. Protein Identity and Related Structures Protein Identity & Related Structures

Envelop protein OPG153

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9shd__assembly_1__model_1

9shd__assembly_1__model_1 | I(q)

9shd__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 water

7. Citations (1)

Structure of vaccinia virus A26 (residues 1-397) in complex with Fab 10M2146

1. Protein Identity and Related Structures Protein Identity & Related Structures

Envelop protein OPG153

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9shd__assembly_1__model_1

9shd__assembly_1__model_1 | I(q)

9shd__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 water

7. Citations (1)