← Back to search

9snv

CTLH-CRA domains of the RanBP9-muskelin complex

Method: X-RAY DIFFRACTION D_max: 85.2 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9snv
deposition_date	2025-09-11
last_revision	2026-02-18
title	CTLH-CRA domains of the RanBP9-muskelin complex
keywords	RanBPM, CTLH complex, Gid complex, E3 ligase, LIGASE; LIGASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	24.35 Å
rg_electron	23.83 Å
i0	18353300.00
molecular_weight	31554.0 kDa
excluded_volume	39173 Å³
envelope_volume	49377 Å³
shell_volume	19028 Å³
envelope_diameter	88.8 Å
shell_rg	28.69 Å
envelope_rg	24.22 Å
shape_rg	23.74 Å
total_rg	24.74 Å
total_atoms	2205
n_residues	272
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	85.2 Å
rg_real	24.65 Å
rg_real_error	0.80 Å
i0_real	1.8350e+07
i0_real_error	2.8070e+05
rg_reciprocal	24.58 Å
i0_reciprocal	18350000.0000
total_estimate	0.8095
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	23.0 Å
skewness	0.611
kurtosis	-0.108
angular_range	— – 0.3250 Å⁻¹
current_alpha	0.0000
highest_alpha	3046000.0000
n_real_points	64
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.696; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.627; Smooth: 0.806

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (5)

Entity 1 polymer

description	Muskelin
formula_weight	15984.0 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	2229

GPMLTDMHDKLVLKGDFDACEELIEKAVNDGLFNQYISQQEYRPSKDYLLRHCKYLIRKHRFEEKAQMDPLSALKYLQNDLYITVDHSDPEETKEFQLLASALFKSGSDFTALGFSDVDHTYAQRTQLFDTLVNFFP

Source

organism	Rattus norvegicus
common_name	Norway rat
ncbi_taxonomy_id	10116
host_organism	Escherichia coli

Entity 2 polymer

description	Ran-binding protein 9
formula_weight	19116.1 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

MEELASIKNRQRIQKLVLAGRMGEAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVRCLGGGGSQAAIERMIHFGRELQAMSEQLRRECGKNTANKKMLKDAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARS

Source

organism	Mus musculus
common_name	house mouse
ncbi_taxonomy_id	10090
host_organism	Escherichia coli

Entity 3 non-polymer

description	NICKEL (II) ION
formula_weight	58.7 kDa
src_method	syn
entity_count	2

Entity 4 non-polymer

description	CHLORIDE ION
formula_weight	35.5 kDa
src_method	syn
entity_count	3

Entity 5 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	23

▶

6. Citations (1)

▶

length_a	84.086 Å
length_b	84.086 Å
length_c	228.282 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	120.00 °
z_pdb	12

space_group	P 61 2 2
int_tables_number	178
crystal_system	hexagonal

resolution	1.965 Å
resolution_low	44.919 Å
r_factor	0.2294
r_work	0.2280
r_free	0.2549

fit	/app/data/saxs_computation/sn/9snv/9snv.fit
pddf	/app/data/pr_computation/sn/9snv/9snv.pr.out
profile	/app/data/saxs_computation/sn/9snv/9snv.dat

CTLH-CRA domains of the RanBP9-muskelin complex

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (5)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 non-polymer

Entity 4 non-polymer

Entity 5 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)