SAXSdb — 9soj

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Novel 3_1 knotted solenoid

Brevundimonas sp. SH203

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	1,2-ETHANEDIOL × 4 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A1V1V225_9CAUL
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 8–139； UniProt 1–132 Author chain B； PDBConstruct 8–139； UniProt 1–132 Author chain C； PDBConstruct 8–139； UniProt 1–132 Author chain D； PDBConstruct 8–139； UniProt 1–132

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9soj
Deposition date deposition_date	2025-09-13
Structure title title	Protein with novel 3_1 knotted solenoid fold
Keywords keywords	3_1 Knot, Novel Fold, Solenoid, Brevundimonas sp., UNKNOWN FUNCTION; UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9soj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9soj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9soj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.10 Å
Rg (electron density)	18.79 Å
Total Rg	19.81 Å
Atom count	3822
Residues	264
Excluded volume	34600 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9soj__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`9soj__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Novel 3_1 knotted solenoid
Molecular weight formula_weight	14823.9 kDa
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	8417

QGIDPFTMTSILPINRPPADAPDLNAKTFENVDIILYELFTAAAAKGVPLIEGRTFRGCRFQGPAIVLASTGVTFSDTNFGESRGGVANLLLRPVGDKAIGTIPMRDCHFIGCEFYGVGFTGPESFIAEVSTLTDKPKA

Source Source

Source organism organism	Brevundimonas sp. SH203
NCBI taxonomy ID ncbi_taxonomy_id	345167
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	680

▶

Unit-cell length a length_a	82.090 Å
Unit-cell length b length_b	82.302 Å
Unit-cell length c length_c	88.050 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	orthorhombic

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	38.820 Å
R factor r_factor	0.1653
R_work r_work	0.1629
R_free r_free	0.2114

Protein with novel 3_1 knotted solenoid fold

1. Protein Identity and Related Structures Protein Identity & Related Structures

Novel 3_1 knotted solenoid

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9soj__assembly_1__model_1

9soj__assembly_1__model_1 | I(q)

9soj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)

Protein with novel 3_1 knotted solenoid fold

1. Protein Identity and Related Structures Protein Identity & Related Structures

Novel 3_1 knotted solenoid

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9soj__assembly_1__model_1

9soj__assembly_1__model_1 | I(q)

9soj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

7. Citations (1)