SAXSdb — 9st8

▼

1. Structure Basics

entry_id	9st8
deposition_date	2025-09-26
last_revision	2026-05-13
title	Structure of IglFC:IglGN complex
keywords	Type VI secretion system Spike contractile injection system Francisella, TOXIN; TOXIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	41.08 Å
rg_electron	40.47 Å
i0	301356000.00
molecular_weight	147740.0 kDa
excluded_volume	187810 Å³
envelope_volume	254690 Å³
shell_volume	54042 Å³
envelope_diameter	136.8 Å
shell_rg	44.50 Å
envelope_rg	39.96 Å
shape_rg	40.44 Å
total_rg	40.80 Å
total_atoms	10384
n_residues	1269
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	129.4 Å
rg_real	41.01 Å
rg_real_error	1.05 Å
i0_real	3.0140e+08
i0_real_error	4.9620e+06
rg_reciprocal	41.08 Å
i0_reciprocal	301400000.0000
total_estimate	0.8881
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	51.1 Å
skewness	0.210
kurtosis	-0.415
angular_range	— – 0.1900 Å⁻¹
current_alpha	0.0000
highest_alpha	17580000.0000
n_real_points	39
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.954; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.997; Smooth: 0.682

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (7)

Entity 1 polymer

description	IglF C-terminal domain
formula_weight	31897.9 kDa
src_method	man
entity_count	4

Polymer

type	polypeptide(L)
strand_id	G,A,E,C
atom_count	10445

DIFKSESLEQLIFSLKNISNIMFDEETLYKKTHIKNQLYKNLFLNNHNSLIEDIIEKSPANLLTKLANKYFQILLDIATMINIQLVNNDLKLIYPFLEFEKYFNQVTLEVSKKSQFNQEKLEKNILNIIRIYPLLNQNYQLLKDMEQKIIDDKNSIESNDIYKLSVFVNSKSFSTYKEIKTLTSNDHKDINIHKSLVKVNKNICNAKHKNAAETAKELTMVLLSKSYYMNPTLIGVYNLPPISNSFFLVLKEITNNPIIDSIKSKQEAYWKI

Source

organism	Francisella tularensis subsp. novicida
ncbi_taxonomy_id	264
host_organism	Escherichia coli

Entity 2 polymer

description	IglC N-terminal domain
formula_weight	6103.9 kDa
src_method	man
entity_count	4

Polymer

type	polypeptide(L)
strand_id	H,B,F,D

MLNIINDSLKRLEEITTDDESISSSVSDLVADLNNIKILLAQSKLHLSSNASILTT

Source

organism	Francisella tularensis subsp. novicida
ncbi_taxonomy_id	264
host_organism	Escherichia coli

Entity 3 non-polymer

description	MAGNESIUM ION
formula_weight	24.3 kDa
src_method	syn
entity_count	4

Entity 4 non-polymer

description	SULFATE ION
formula_weight	96.1 kDa
src_method	syn
entity_count	12

Entity 5 non-polymer

description	GLYCEROL
formula_weight	92.1 kDa
src_method	syn
entity_count	5

Entity 6 non-polymer

description	DI(HYDROXYETHYL)ETHER
formula_weight	106.1 kDa
src_method	syn
entity_count	2

Entity 7 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	61

▶

6. Citations (1)

▶

length_a	187.220 Å
length_b	187.220 Å
length_c	113.052 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	120.00 °
z_pdb	24

space_group	P 31 2 1
int_tables_number	152
crystal_system	—

resolution	3.300 Å
resolution_low	61.280 Å
r_factor	0.2168
r_work	0.2147
r_free	0.2563

fit	/app/data/saxs_computation/st/9st8/9st8.fit
pddf	/app/data/pr_computation/st/9st8/9st8.pr.out
profile	/app/data/saxs_computation/st/9st8/9st8.dat

Structure of IglFC:IglGN complex

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (7)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 non-polymer

Entity 4 non-polymer

Entity 5 non-polymer

Entity 6 non-polymer

Entity 7 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)