← Back to search

9sxc

Crystal structure of the Legionella pneumophila effector SidL (Lpg0437) in complex with its metaeffector LegA11 (Lpg0436)

Method: X-RAY DIFFRACTION D_max: 88.6 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9sxc
deposition_date	2025-10-09
title	Crystal structure of the Legionella pneumophila effector SidL (Lpg0437) in complex with its metaeffector LegA11 (Lpg0436)
keywords	Legionella, effector, HYDROLASE; HYDROLASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	28.34 Å
rg_electron	27.55 Å
i0	92674400.00
molecular_weight	77767.0 kDa
excluded_volume	98354 Å³
envelope_volume	119700 Å³
shell_volume	36010 Å³
envelope_diameter	96.7 Å
shell_rg	35.05 Å
envelope_rg	27.49 Å
shape_rg	27.53 Å
total_rg	28.37 Å
total_atoms	5472
n_residues	682
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	88.6 Å
rg_real	28.20 Å
rg_real_error	0.47 Å
i0_real	9.2670e+07
i0_real_error	1.3810e+06
rg_reciprocal	28.25 Å
i0_reciprocal	92680000.0000
total_estimate	0.9082
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	2
r_peak_primary	34.8 Å
skewness	0.177
kurtosis	-0.535
angular_range	— – 0.2800 Å⁻¹
current_alpha	0.0000
highest_alpha	26760000.0000
n_real_points	57
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.940; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.983

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Dot/Icm secretion system substrate
formula_weight	70873.1 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	5658

GAMGGSTEKLSVLSKKVAEDVVKVSNQTVQKINEVTKKFTVDTTVSTIDTQKILDDFMKNIRFSRFKQIWQAIEKTPKSKHILLKSLFLKGLLTHNKPLLEEIIRQIELIPYSSDLEMLGAFSQDKAHPLSPELLEFVQEMLANESEKVLLTILMNAFQSIPELSLDSKTGTLSMKTKKALLPLLIEKVDTSIAKSIMSQLTDISFDSVLPAFRPSIGDPSYQKTNINLNKYLSLVGNKTDISEFLILTIGLFTSLKIGDKGFLQELSADYLFVRYDDCLHKIIEKLKEKEVIEQLGEKEVQKILEASGNLKRFKPTSNNPRRFFETRLAQYINGLSHSEKTIEIDSIGEDKEPEDEELRDNTLKACNKILQFFLGDCGRVDTPREMEQKICIFANGYKDTSKFTKKEVEFITGVLHHAGAHKGRDRVERDKLTGIKERKFETDSEKVGSDVWNCGGGVMKGCSPVFYDAQRDPMRNMLVDSSTVAPDNKEGKQWFWNNNRQYSSYVGSISGHTCNIVGMLAKYMTEYKEDLDLQNDINLFLIQVIGVYAKRGFHAMLEVIDVLHDPYVQDIFKGYGVQVNLYSYFKENPELAGFLQHAMNDATTYTQALVNKKHVKEALKSNS

Source

organism	Legionella pneumophila
ncbi_taxonomy_id	446
host_organism	Escherichia coli BL21

Entity 2 polymer

description	Ankyrin repeat-containing protein
formula_weight	31153.6 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

GAMGGSMIKMGRSEMKIASAELRELMKAVSEGHYETVNTILDKDPELVNQYAPPTYDSPLARVLNKKHIDYKMLDILVKHHVDFDYPINYHKETPIELACKNQDLQLFKYLVQHNAPISEQAPHFLLVNSTNIKYLTEDKIKNTCEIIKLMGGLEAVSSKCDAEGNRFGEQARKSQLINRFGGIVKYDYMQLLQSVYPIVDREVDAPTIHGSTEVLTNLLNKIRGQFSSKETYDQQNLKDSISLFFMTGGEIPPSRKVPESRFEEAGIDTPKNAL

Source

organism	Legionella pneumophila
ncbi_taxonomy_id	446
host_organism	Escherichia coli BL21(DE3)

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	186

▶

6. Citations (2)

▶

length_a	68.530 Å
length_b	93.380 Å
length_c	133.670 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	4

space_group	P 21 21 21
int_tables_number	19
crystal_system	—

resolution	2.400 Å
resolution_low	47.850 Å
r_factor	—
r_work	0.2244
r_free	0.2675

fit	/app/data/saxs_computation/sx/9sxc/9sxc.fit
pddf	/app/data/pr_computation/sx/9sxc/9sxc.pr.out
profile	/app/data/saxs_computation/sx/9sxc/9sxc.dat

Crystal structure of the Legionella pneumophila effector SidL (Lpg0437) in complex with its metaeffector LegA11 (Lpg0436)

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 water

6. Citations (2)

7. Files & Curves (10)

Files (7)

Curves (3)