SAXSdb — 9t1m

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nuclear export protein

Influenza A virus (A/WSN/1933(H1N1))

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 4	Alpha Rep E4 × 3 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0ABF7SXM9_9INFA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–121； UniProt 1–121

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9t1m
Deposition date deposition_date	2025-10-21
Structure title title	Nuclear export protein/Non-structural protein 2 (NEP/NS2) in complex with artificial alpha Rep protein
Keywords keywords	Nuclear export protein, non-structural protein 2, influenza virus, synthetic protein, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9t1m__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9t1m__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9t1m__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.50 Å
Rg (electron density)	28.76 Å
Total Rg	29.45 Å
Atom count	4552
Residues	578
Excluded volume	80987 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9t1m__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Alpha Rep E4
Molecular weight formula_weight	18903.5 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E
Atom count atom_count	4669

MRGSHHHHHHTDPEKVEMYIKNLQDDSPLVRDFAANALGKIGDERAVEPLIKALKDEDGYVRRTAALALGKIGDERAVEPLIKALKDEDWQVRAQAADALGQIGDERAVEPLIKALKDEDRYVRWRAASALGKIGGERVRAAMEKLAETGTGFARKVAVNYLETHKSLIS

Source Source

Source organism organism	synthetic construct
NCBI taxonomy ID ncbi_taxonomy_id	32630
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Nuclear export protein
Molecular weight formula_weight	14343.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MDPNTVSSFQDILMRMSKMQLGSSSEDLNGIITQFESLKLYRDSLGEAVMRMGDLHSLQNRNGKWREQLGQKFEEIRWLIEEVRHRLKITENSFEQITFMQALQLLLEVEQEIRTFSFQLI

Source Source

Source organism organism	Influenza A virus (A/WSN/1933(H1N1))
NCBI taxonomy ID ncbi_taxonomy_id	382835
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	117

▶

Unit-cell length a length_a	136.809 Å
Unit-cell length b length_b	136.809 Å
Unit-cell length c length_c	71.362 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	P 32 2 1
Space-group number int_tables_number	154
Crystal system crystal_system	trigonal

Resolution resolution	2.330 Å
Low-resolution limit resolution_low	68.400 Å
R factor r_factor	0.2188
R_work r_work	0.2172
R_free r_free	0.2489

Nuclear export protein/Non-structural protein 2 (NEP/NS2) in complex with artificial alpha Rep protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nuclear export protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9t1m__assembly_1__model_1

9t1m__assembly_1__model_1 | I(q)

9t1m__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (2)

Nuclear export protein/Non-structural protein 2 (NEP/NS2) in complex with artificial alpha Rep protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

Nuclear export protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9t1m__assembly_1__model_1

9t1m__assembly_1__model_1 | I(q)

9t1m__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

7. Citations (2)