9t5u

Chlorophyll f-containing monomeric far-red Photosystem II from Calothrix sp. NIES-3974

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

No usable UniProt protein identity is available for this entry.

The relationship tables retain this entry's assembly and composition data, but cross-PDB links for the same protein cannot be established reliably without a unified protein identity.

Assembly Composition of the Current Entry

Assembly	Physical composition	Protein state	蛋白 / DNA / RNA / 其他Polymer	Data consistency
1	Protein heterocomplex	Heteromer	17 / 0 / 0 / 0	Consistent with protein count

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9t5u
Deposition date deposition_date	2025-11-06
Structure title title	Chlorophyll f-containing monomeric far-red Photosystem II from Calothrix sp. NIES-3974
Keywords keywords	Chlorophyll f, photosystem II, ELECTRON TRANSPORT, FaRLiP; ELECTRON TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9t5u__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9t5u__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9t5u__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	40.91 Å
Rg (electron density)	39.74 Å
Total Rg	40.28 Å
Atom count	21332
Residues	2174
Excluded volume	398730 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9t5u__assembly_1__model_1`	17-meric （17）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (34)

Entity 1 Entity 1 polymer

Description description	PsbA
Molecular weight formula_weight	40209.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	21449

MTTISQPKTTRFPAWERFCDWITSTENRLYIGWFGVLMIPLLGVSICVFVIAFIAAPPVDIDGIREPVAGSIFYGNNIITAAVVPMSNAIGLHFYPIWEAASMDEWLYNGGPYQMIAFHYIPALACYMGREWELSYRLGMRPWIAVAYSAPLAATTSVFLIYPIGQGSFSDGLPMGISGTFNFMFVFQAEHNILMHPLHMIGVAGVLGGSLFCAMHGSLVTSSIIRETTELESQNYGYKFGQEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVICIWGTAIGISTMAFNLNGFNFNNSILDSQGRVLPSWADVLNRANLGFEVMHERNAHNFPLDLASGEAIPVPVAMAAPSITM

Entity 2 Entity 2 polymer

Description description	PsbB
Molecular weight formula_weight	56801.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MGLPWYRVHTVVLNDPGRLIAVHLMHTALTAGWAGSMALYELALFDPSDSVFNPMWRQGMFVLPFMTRLGITQSWAGWNITGEAVNGFTLWTFESVAAAHIILAGLLFLAACWHWVYWDLELFQDPKSGESFLDLPKIFGIHLLLAGLLCFGFGAFHLTGIFGPGMWVSDPYGLTGHIQGVAPEWGPDGFNPYNPGGVVAHHIAAGIVGIIGGIFHISVRPPEVLYRTLRMGNIETVLASALATFFFAAFVVSGTMWYGTATTPIELFGPTRYQWDSSYFQTEISRRVQTSLNQGATLAEAWSNIPDKLAFYDYVGNSPAKGGLFRVGPMVKGDGVALSWLGHPVFQDREGRELIVRRMPNFFETFPVVLTDKDNIVRADIPFRRADSKLSFEQTGVTVSFLGGALNGQTFSDPVEVKKYARRAQLGEIFAFDTQTFKSDGIFRTSTRGWFAFAHACWGLLWFFGHIWHGARTIFRDVFAGIDPELDEEQVEFGVFQKVGDVSTRKKQLV

Entity 3 Entity 3 polymer

Description description	PsbC
Molecular weight formula_weight	50618.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

METPLDISITTTISPPASEGRDEPSTGYAWWAGNARFVNKSGRFLGAHVAHAGLVAFWAGAMLLFEVAHYTPEKPMYEQGLILMPHIATLGIGVGHGGEVTDIFPFFAIAVAHLIGSAVLGFGGLYHSLKGPEKLAGFFDFDWRDKNKVTSILGFHLIALGVAAYLLVGKAMIWGGLYDTWAPGGGDVRLVTNPTLDPRIIFGYLLKPFTGGQGSIVSVNNLEDLVGGHIWIGGILILGGIWHIITEPFKWTHKVFIWSGEAYLSQSLGNVAGQAIIATMFIWFNNTAYPSEFYGPTAPEASQAQALIFVVRDQKLGANVASAQGPTGLGKYLMRSPTGEIIFGGETMRFWDVRAPWLEPLRGPNGLDIKKIQNDIQPWQIRRAAEYMTHAPLGSLNSVGGVATEINSFNFVSPRTWLAAAHFVFFLLFLVGHLWHAGRARAAAAGFERGLDRQDEPVLSMKPLD

Entity 4 Entity 4 polymer

Description description	PsbD
Molecular weight formula_weight	39942.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MTIAIRPTQSNWRWFYILDDWLKRDRFVFIGWSGLLLFPCAYLAIGGWFTGTTFVSSWYTHGVVSSYLEGCNFLTAAVSTPADSMGHSLLLLWGPEAEGNITRWFQIGGLWNFVAFHGVFGLIGFMLRQFEIARTIGIRPYNAIAFSAPIAVFVSVFLIYPLGQSSWFFAPSFGVAAIFRFLLFFQAFHNYTLNPFHMMGVAGVLGGALLCAIHGATVENTLFKDTTGFNTFRGFSTTQAEETYSFVTANRYWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGMVGLAFNLRAYDFISQELRAAEDPEFETFYTKNILLNEGARAWMAPQDQPHEHFQFPEEVLPRGNAL

Entity 5 Entity 5 polymer

Description description	PsbE
Molecular weight formula_weight	9382.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MSGTTGERPFGDIITSIRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPNEYFTQTRQELPIVSDRYESKKQVEQFIGK

Entity 6 Entity 6 polymer

Description description	PsbF
Molecular weight formula_weight	5224.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MTSSNNLNQPVQQYPIFTVRWLAVHTLAVPTVFFLGAIAAMQFIQR

Entity 7 Entity 7 polymer

Description description	PsbH
Molecular weight formula_weight	7636.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MAQRTRLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFFVFLLIILQLYNKSIIIQDVMVDWRSLGN

Entity 8 Entity 8 polymer

Description description	PsbI
Molecular weight formula_weight	4367.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MLALKVVVYIVVAFFVSLFVFGFLSNDPARNPGRRDFE

Entity 9 Entity 9 polymer

Description description	PsbJ
Molecular weight formula_weight	3872.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSGGGRIPLWIVATVAGLGVITVVGIFFYGAYAGLGSSI

Entity 10 Entity 10 polymer

Description description	PsbK
Molecular weight formula_weight	5062.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MEAAILLAKLPEAYQIFDPLVDVLPIIPVFFLLLAFVWQAAVGFR

Entity 11 Entity 11 polymer

Description description	PsbL
Molecular weight formula_weight	4546.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MERTPNPNNQPVELNRTSLFLGLLLIFVLGILFSSYFFN

Entity 12 Entity 12 polymer

Description description	PsbM
Molecular weight formula_weight	4300.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MQVNDLGFVASLLFVLVPSVFLIILYTLTASREGGQKDN

Entity 13 Entity 13 polymer

Description description	PsbY
Molecular weight formula_weight	4444.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MDIDFRIAIVLAPIAVAAGWAVFNIGRAALVQLQNFLNKEA

Entity 14 Entity 14 polymer

Description description	PsbT
Molecular weight formula_weight	3973.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MESIAYVLIFAVTLGILFFAIAFREPPRIQKKEK

Entity 15 Entity 15 polymer

Description description	PsbX
Molecular weight formula_weight	4381.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MTPSLANFLWSLFWGTVIVVIPATVALIFISQSDKIQRS

Entity 16 Entity 16 polymer

Description description	Ycf12
Molecular weight formula_weight	4421.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MFEALASIKWEVIFQLTAVALIMLSGPIVIFLLAVRKGDL

Entity 17 Entity 17 polymer

Description description	PsbZ
Molecular weight formula_weight	6740.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

MTFIFQFALLALVVVSFAMVIGVPVAYATPQSWVESKKLLWLGSAVWAALVVLVGILNFLVV

Entity 18 Entity 18 non-polymer

Description description	CA-MN4-O5 CLUSTER
Molecular weight formula_weight	339.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 non-polymer

Description description	FE (II) ION
Molecular weight formula_weight	55.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 20 Entity 20 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 21 Entity 21 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	32

Entity 22 Entity 22 non-polymer

Description description	CHLOROPHYLL D
Molecular weight formula_weight	895.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 23 Entity 23 non-polymer

Description description	PHEOPHYTIN A
Molecular weight formula_weight	871.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 24 Entity 24 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	10

Entity 25 Entity 25 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 26 Entity 26 non-polymer

Description description	;2,3-DIMETHYL-5-(3,7,11,15,19,23,27,31,35-NONAMETHYL-2,6,10,14,18,22,26,30,34-HEXATRIACONTANONAENYL-2,5-CYCLOHEXADIENE-1,4-DIONE-2,3-DIMETHYL-5-SOLANESYL-1,4-BENZOQUINONE ;
Molecular weight formula_weight	749.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 27 Entity 27 non-polymer

Description description	DODECYL-BETA-D-MALTOSIDE
Molecular weight formula_weight	510.6 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 28 Entity 28 non-polymer

Description description	1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE
Molecular weight formula_weight	787.2 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 29 Entity 29 non-polymer

Description description	Chlorophyll F
Molecular weight formula_weight	905.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 30 Entity 30 non-polymer

Description description	1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE
Molecular weight formula_weight	723.0 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 31 Entity 31 non-polymer

Description description	DIGALACTOSYL DIACYL GLYCEROL (DGDG)
Molecular weight formula_weight	949.3 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 32 Entity 32 non-polymer

Description description	BICARBONATE ION
Molecular weight formula_weight	61.0 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 33 Entity 33 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 34 Entity 34 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	117

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	2.33 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	285844

Chlorophyll f-containing monomeric far-red Photosystem II from Calothrix sp. NIES-3974

1. Protein Identity and Related Structures Protein Identity & Related Structures

Assembly Composition of the Current Entry

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9t5u__assembly_1__model_1

9t5u__assembly_1__model_1 | I(q)

9t5u__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (34)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 polymer

Polymer Polymer

Entity 12 Entity 12 polymer

Polymer Polymer

Entity 13 Entity 13 polymer

Polymer Polymer

Entity 14 Entity 14 polymer

Polymer Polymer

Entity 15 Entity 15 polymer

Polymer Polymer

Entity 16 Entity 16 polymer

Polymer Polymer

Entity 17 Entity 17 polymer

Polymer Polymer

Entity 18 Entity 18 non-polymer

Entity 19 Entity 19 non-polymer

Entity 20 Entity 20 non-polymer

Entity 21 Entity 21 non-polymer

Entity 22 Entity 22 non-polymer

Entity 23 Entity 23 non-polymer

Entity 24 Entity 24 non-polymer

Entity 25 Entity 25 non-polymer

Entity 26 Entity 26 non-polymer

Entity 27 Entity 27 non-polymer

Entity 28 Entity 28 non-polymer

Entity 29 Entity 29 non-polymer

Entity 30 Entity 30 non-polymer

Entity 31 Entity 31 non-polymer

Entity 32 Entity 32 non-polymer

Entity 33 Entity 33 non-polymer

Entity 34 Entity 34 water

7. Citations (1)