SAXSdb — 9tbj

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Secreted acid phosphatase 1 (SAP1)

Leishmania mexicana

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Homooligomer	Protein 3 其他Polymer 9	alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 2 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 7 2-acetamido-2-deoxy-beta-D-glucopyranose × 6 PHOSPHATE ION × 3 water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q25332_LEIME
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–516； UniProt 1–537 Author chain B； PDBConstruct 1–516； UniProt 1–537 Author chain C； PDBConstruct 1–516； UniProt 1–537

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9tbj
Deposition date deposition_date	2025-11-20
Structure title title	Leishmania mexicana secreted acid phosphatase
Keywords keywords	Leishmania, acid phosphatase, enzyme filaments, HYDROLASE; HYDROLASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9tbj__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9tbj__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9tbj__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.51 Å
Rg (electron density)	42.45 Å
Total Rg	42.63 Å
Atom count	10240
Residues	1267
Excluded volume	180100 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9tbj__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Secreted acid phosphatase 1 (SAP1)
Molecular weight formula_weight	62175.7 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	10259

MASRLVRVLAAAMLVAAAVSVDAHFVVRMVQVVHRHGARSALIDDNTTEICGTLYPCGELTGEGVEMVRAIGEFARSRYNNLSLVESPLFPSTRYNSSVVHTRSTHTQRTIQSATAFLRGLFQDDNFYPVVYSTNRTTETLLSTDAVPSVVARSWLDNPALHAALNPVIDEHLSWDAIQCAAKDAWVEGLCADYNARTSCVLDMYDVAAAFEAAGRLDNATNLKAVYPGLQEVNAAWFKYVFSWNHTSKLDLTQGSASQNLAQTVLANINAHRLSPSYNMFQYSAHDTTVTPLAVTFGDQGETTMRPPFAVTIFVELLQDTADASGWYVRLIRGNPVKAADGTYVFQESGIKAYCIDEAGNKYLAHTGICPLNNFRRMIDYSRPAVADGHCTMTQTQYSNMDCPPTIADNKSVPSRCWLYRYVCPSKACPDSYILSAVDHQCYPGSDVTNLTSSSSKSTSSSDVPSFKKPANWSPRVLSPERGRHIAGDIIRGVTNGVTIGAGVRKHDEYSRHRQQSRMDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREPSGGCKLGLY

Source Source

Source organism organism	Leishmania mexicana
NCBI taxonomy ID ncbi_taxonomy_id	5665
Host organism host_organism	Leishmania mexicana

Entity 2 Entity 2 branched

Description description	alpha-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	nat
Copy count entity_count	2

Entity 3 Entity 3 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	nat
Copy count entity_count	7

Entity 4 Entity 4 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	nat
Copy count entity_count	6

Entity 5 Entity 5 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	nat
Copy count entity_count	3

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	19

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	triclinic

Resolution resolution	3.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	524666

Leishmania mexicana secreted acid phosphatase

1. Protein Identity and Related Structures Protein Identity & Related Structures

Secreted acid phosphatase 1 (SAP1)

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9tbj__assembly_1__model_1

9tbj__assembly_1__model_1 | I(q)

9tbj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 branched

Entity 3 Entity 3 branched

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)

Leishmania mexicana secreted acid phosphatase

1. Protein Identity and Related Structures Protein Identity & Related Structures

Secreted acid phosphatase 1 (SAP1)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9tbj__assembly_1__model_1

9tbj__assembly_1__model_1 | I(q)

9tbj__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 branched

Entity 3 Entity 3 branched

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Citations (1)