← Back to search

9tie

Phage 812 baseplate in the pre-contraction state - tail sheath initiator and baseplate-proximal tail proteins

Method: ELECTRON MICROSCOPY D_max: 198.6 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9tie
deposition_date	2025-12-05
title	Phage 812 baseplate in the pre-contraction state - tail sheath initiator and baseplate-proximal tail proteins
keywords	phage, baseplate, VIRUS; VIRUS
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	58.43 Å
rg_electron	58.20 Å
i0	2755130000.00
molecular_weight	438000.0 kDa
excluded_volume	547370 Å³
envelope_volume	873710 Å³
shell_volume	124420 Å³
envelope_diameter	208.8 Å
shell_rg	61.01 Å
envelope_rg	57.36 Å
shape_rg	58.18 Å
total_rg	58.33 Å
total_atoms	30870
n_residues	3956
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	198.6 Å
rg_real	58.37 Å
rg_real_error	1.68 Å
i0_real	2.7550e+09
i0_real_error	5.3010e+07
rg_reciprocal	58.45 Å
i0_reciprocal	2755000000.0000
total_estimate	0.8727
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	66.2 Å
skewness	0.309
kurtosis	-0.420
angular_range	— – 0.1350 Å⁻¹
current_alpha	0.0001
highest_alpha	313100000.0000
n_real_points	28
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.838; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.828

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	ORF61
formula_weight	26611.8 kDa
src_method	nat
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,H
atom_count	30870

MRFKKHVVQHEETMQAIAQRYYGDVSYWIDLVEHNNLKYPYLVETDEEKMKDPERLASTGDTLIIPIESDLTDVSAKEINSRDKDVLVELALGRDLNITADEKYFNEHGTSDNILAFSTNGNGDLDTVKGIDNMKQQLQARLLTPRGSLMLHPNYGSDLHNLFGLNIPEQATLIEMEVLRTLTSDNRVKSANLIDWKIQGNVYSGQFSVEIKSVEESINFVLGQDEEGIFALFE

Entity 2 polymer

description	ORF49
formula_weight	64559.0 kDa
src_method	nat
entity_count	6

Polymer

type	polypeptide(L)
strand_id	B,C,D,I,J,K

MAVEPFPRRPITRPHASIEVDTSGIGGSAGSSEKVFCLIGQAEGGEPNTVYELRNYSQAKRLFRSGELLDAIELAWGSNPNYTAGRILAMRIEDAKPASAEIGGLKITSKIYGNVANNIQVGLEKNTLSDSLRLRVIFQDDRFNEVYDNIGNIFTIKYKGEEANATFSVEHDEETQKASRLVLKVGDQEVKSYDLTGGAYDYTNAIITDINQLPDFEAKLSPFGDKNLESSKLDKIENANIKDKAVYVKAVFGDLEKQTAYNGIVSFEQLNAEGEVPSNVEVEAGEESATVTATSPIKTIEPFELTKLKGGTNGEPPATWADKLDKFAHEGGYYIVPLSSKQSVHAEVASFVKERSDAGEPMRAIVGGGFNESKEQLFGRQASLSNPRVSLVANSGTFVMDDGRKNHVPAYMVAVALGGLASGLEIGESITFKPLRVSSLDQIYESIDLDELNENGIISIEFVRNRTNTFFRIVDDVTTFNDKSDPVKAEMAVGEANDFLVSELKVQLEDQFIGTRTINTSASIIKDFIQSYLGRKKRDNEIQDFPAEDVQVIVEGNEARISMTVYPIRSFKKISVSLVYKQQTLQA

Entity 3 polymer

description	ORF50
formula_weight	15943.0 kDa
src_method	nat
entity_count	6

Polymer

type	polypeptide(L)
strand_id	E,F,G,L,M,N

MASEAKQTVHTGNTVLLMIKGKPVGRAQSASGQREYGTTGVYEIGSIMPQEHVYLRYEGTITVERLRMKKENFADLGYASLGEEILKKDIIDILVVDNLTKQVIISYHGCSANNYNETWQTNEIVTEEIEFSYLTASDKART

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	—

resolution	3.40 Å
resolution_method	—
num_particles	4071

fit	/app/data/saxs_computation/ti/9tie/9tie.fit
pddf	/app/data/pr_computation/ti/9tie/9tie.pr.out
profile	/app/data/saxs_computation/ti/9tie/9tie.dat

Phage 812 baseplate in the pre-contraction state - tail sheath initiator and baseplate-proximal tail proteins

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

EM 3D

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Entity 2 polymer

Polymer

Entity 3 polymer

Polymer

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)