9tif

Phage 812 baseplate in the pre-contraction state - lower arm

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CBM-cenC domain-containing protein

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	ORF64 × 12 （Q6Y7Q3） ORF57 × 1 （Q6Y7R0） ORF67 × 1 （Q6Y7Q0） ORF65 × 6 （Q6Y7Q2） ORF56 × 1 （Q6Y7R1） ORF68 × 3 （Q6Y7P9） ORF63 × 1 （Q6Y7Q4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A0U1UXW5_9CAUD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–640； UniProt 1–640 Author chain B； PDBConstruct 1–640； UniProt 1–640 Author chain J； PDBConstruct 1–640； UniProt 1–640

ORF64

OrganismNot specified

UniProt Q6Y7Q3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	CBM-cenC domain-containing protein × 3 （A0A0U1UXW5） ORF57 × 1 （Q6Y7R0） ORF67 × 1 （Q6Y7Q0） ORF65 × 6 （Q6Y7Q2） ORF56 × 1 （Q6Y7R1） ORF68 × 3 （Q6Y7P9） ORF63 × 1 （Q6Y7Q4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7Q3_BPPGK
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain D； PDBConstruct 1–173； UniProt 1–173 Author chain E； PDBConstruct 1–173； UniProt 1–173 Author chain I； PDBConstruct 1–173； UniProt 1–173 Author chain K； PDBConstruct 1–173； UniProt 1–173 Author chain L； PDBConstruct 1–173； UniProt 1–173 Author chain N； PDBConstruct 1–173； UniProt 1–173 Author chain O； PDBConstruct 1–173； UniProt 1–173 Author chain P； PDBConstruct 1–173； UniProt 1–173 Author chain Q； PDBConstruct 1–173； UniProt 1–173 Author chain R； PDBConstruct 1–173； UniProt 1–173 Author chain V； PDBConstruct 1–173； UniProt 1–173 Author chain c； PDBConstruct 1–173； UniProt 1–173

ORF57

OrganismNot specified

UniProt Q6Y7R0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	CBM-cenC domain-containing protein × 3 （A0A0U1UXW5） ORF64 × 12 （Q6Y7Q3） ORF67 × 1 （Q6Y7Q0） ORF65 × 6 （Q6Y7Q2） ORF56 × 1 （Q6Y7R1） ORF68 × 3 （Q6Y7P9） ORF63 × 1 （Q6Y7Q4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7R0_BPPGK
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain F； PDBConstruct 1–295； UniProt 1–295

ORF67

OrganismNot specified

UniProt Q6Y7Q0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	CBM-cenC domain-containing protein × 3 （A0A0U1UXW5） ORF64 × 12 （Q6Y7Q3） ORF57 × 1 （Q6Y7R0） ORF65 × 6 （Q6Y7Q2） ORF56 × 1 （Q6Y7R1） ORF68 × 3 （Q6Y7P9） ORF63 × 1 （Q6Y7Q4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7Q0_BPPGK
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain G； PDBConstruct 1–124； UniProt 1–124

ORF65

OrganismNot specified

UniProt Q6Y7Q2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	CBM-cenC domain-containing protein × 3 （A0A0U1UXW5） ORF64 × 12 （Q6Y7Q3） ORF57 × 1 （Q6Y7R0） ORF67 × 1 （Q6Y7Q0） ORF56 × 1 （Q6Y7R1） ORF68 × 3 （Q6Y7P9） ORF63 × 1 （Q6Y7Q4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7Q2_BPPGK
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain H； PDBConstruct 1–1152； UniProt 1–1152 Author chain d； PDBConstruct 1–1152； UniProt 1–1152 Author chain e； PDBConstruct 1–1152； UniProt 1–1152 Author chain f； PDBConstruct 1–1152； UniProt 1–1152 Author chain g； PDBConstruct 1–1152； UniProt 1–1152 Author chain h； PDBConstruct 1–1152； UniProt 1–1152

ORF56

OrganismNot specified

UniProt Q6Y7R1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	CBM-cenC domain-containing protein × 3 （A0A0U1UXW5） ORF64 × 12 （Q6Y7Q3） ORF57 × 1 （Q6Y7R0） ORF67 × 1 （Q6Y7Q0） ORF65 × 6 （Q6Y7Q2） ORF68 × 3 （Q6Y7P9） ORF63 × 1 （Q6Y7Q4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7R1_BPPGK
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain M； PDBConstruct 1–808； UniProt 1–808

ORF68

OrganismNot specified

UniProt Q6Y7P9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	CBM-cenC domain-containing protein × 3 （A0A0U1UXW5） ORF64 × 12 （Q6Y7Q3） ORF57 × 1 （Q6Y7R0） ORF67 × 1 （Q6Y7Q0） ORF65 × 6 （Q6Y7Q2） ORF56 × 1 （Q6Y7R1） ORF63 × 1 （Q6Y7Q4）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7P9_BPPGK
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain S； PDBConstruct 1–458； UniProt 1–458 Author chain T； PDBConstruct 1–458； UniProt 1–458 Author chain U； PDBConstruct 1–458； UniProt 1–458

ORF63

OrganismNot specified

UniProt Q6Y7Q4

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 28	CBM-cenC domain-containing protein × 3 （A0A0U1UXW5） ORF64 × 12 （Q6Y7Q3） ORF57 × 1 （Q6Y7R0） ORF67 × 1 （Q6Y7Q0） ORF65 × 6 （Q6Y7Q2） ORF56 × 1 （Q6Y7R1） ORF68 × 3 （Q6Y7P9）	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q6Y7Q4_BPPGK
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain b； PDBConstruct 1–1019； UniProt 1–1019

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9tif
Deposition date deposition_date	2025-12-05
Structure title title	Phage 812 baseplate in the pre-contraction state - lower arm
Keywords keywords	phage, baseplate, VIRUS; VIRUS
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9tif__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9tif__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9tif__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	101.10 Å
Total Rg	101.00 Å
Atom count	100209
Residues	12698
Excluded volume	1777500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9tif__assembly_1__model_1`	28-meric （28）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	CBM-cenC domain-containing protein
Molecular weight formula_weight	72654.7 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,J
Atom count atom_count	100209

MAFNYTPLTETQKLKDMYPKVNDIGNFLKTEVNLSDVKQISQPDFNNILASIPDSGNYYVTNSKGAPSGEATAGFVRLDKRNVNYYKIYYSPYSSNKMYIKTYANGTVYDWISFKLDEGSLYNEGNTLNVKELTESTTQYATLVNPPKENLNTGWVNYKESKNGVSSLVEFNPVNSTSTFKMIRKLPVQEQKPNLLKDSLFVYPETSYSNIKTDNWDTPPFWGYSSNSGRSGVRFRGENTVQIDDGSDTYPSVVSNRFKMGKELSVGDTVTVSVYAKINDPALLKDNLVYFELAGYDTVDDTSKNPYTGGRREITASEITTEWKKYSFTFTIPENTIGASGVKVNYVSLLLRMNCSSSKGNGAVVYYALPKLEKSSKVTPFITHENDVRKYDEIWSNWQEVISKDELKGHSPVDIEYNDYFKYQWWKSEVNEKSLKDLAMTVPQGYHTFYCQGSIAGTPKGRSIRGTIQVDYDKCDPYRANKFVKLLFTDTEGIPYTLYYGGYNQGWKPLKQSETSTLLWKGTLDFGSTEAVNLNDSLDNYDLIEVTYWTRSAGHFSTKRLDIKNTSNLLYIRDFNISNDSTGSSVDFFEGYCTFPTRTSVQPGMVKSITLDGSTNTTKVASWNEKERIKVYNIMGINRG

Entity 2 Entity 2 polymer

Description description	ORF64
Molecular weight formula_weight	19259.6 kDa
Source method src_method	nat
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E,I,K,L,N,O,P,Q,R,V,c

MAIATYNSHVELAKYLVSKADSVYLTIGKSTPWSNETNPPQPDENATVLQEVIGYKKATKVTLVRPSKSPEDDNKNLISYGNKSWVEVTPENAKAEGAKWVYLESSIVGDELPLGTYRQVGFVMDLVAKSGISKFNLVPSEVESTGTLLFFDNKQFQNRSEQTTAKERFIVEV

Entity 3 Entity 3 polymer

Description description	ORF57
Molecular weight formula_weight	34645.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MATDKEAKDVIDKFIDNVFNFDVLTKERIKEKDEEIKKITTDDMYEKVVYIRPYVGVIQSLNPQHVQYESFSNNGYDIEAELSFRKVSYLVDKGSIPTDSLSTLTVHLVERNQELLIDYFDEIQDVLYGEYMEEEYVFDEDVPLSTILALDLNDNLKSLSNIKYMFKGAPKENPFGTDKDVYIDTYNLLYWLYLGEDEELAYPMNINYFFTEGRFFTIFGKGHKYKVDVSKFIVGDILFFGRSDTNIGIYVGDGEFISMMGKFPKDETPIGKYKLDDYWNEFNGRVMRFDEEVYI

Entity 4 Entity 4 polymer

Description description	ORF67
Molecular weight formula_weight	14627.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MAVKYDIGNNEIVLHLREGKYITGFTTVGGYDKELGQVKVNREILPAYFFDNFAYERYLYYSKPEEVIENKNYVPPQINDDDEESQQITVPKEQYDSLKEELELMRKQQEAMMEMLQKLLGQKG

Entity 5 Entity 5 polymer

Description description	ORF65
Molecular weight formula_weight	129263.0 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,d,e,f,g,h

MAINFKGSPYLDRFDPSKDRTKVLFNPDRPLQQAELNEMQSIDQYYLKNLGDAIFKDGDKQSGLGFTLSEDNVLTVNPGYVYINGKIRYYDNDDSVKITGVGKETIGIKLTERIVTPDEDASLLDQTSGVPSYFSKGADRLEEKMSLTVNDPTSATIYTFMDGDLYIQSTNAEMDKINKVLAERTYDESGSYKVNGFELFSEGNAEDDDHVSVVVDAGKAYVKGFKVDKPVSTRISVPKSYDLGTAENESTIFNKSNNSISLANSPVKEIRRVTGQVLIEKERVTRGAQGDGQDFLSNNTAFEIVKVWTETSPGVTTKEYKQGEDFRLTDGQTIDWSPQGQEPSGGTSYYVSYKYNKRMEAGKDYEVTTQGEGLSKKWYINFTPSNGAKPIDQTVVLVDYTYYLARKDSVFINKYGDIAILPGEPNIMRLVTPPLNTDPENLQLGTVTVLPDSDEAVCISFAITRLSMEDLQKVKTRVDNLEYNQAVNALDDGAMEGQNPLTLRSVFSEGFISLDKADITHPDFGIVFSFEDAEATLAYTEAVNQPKIIPGDTTAHIWGRLISAPFTEERTIYQGQASETLNVNPYNIPNKQGVLKLTPSEDNWIDTENVTITEQKTKKVTMKRFWRHNESYYGETEHYLYSNLQLDAGQKWKGETYAYDREHGRTGTLLESGGQRTLEEMIEFIRIRDVSFEVKGLNPNDNNLYLLFDGVRCAITPATGYRKGSEDGTIMTDAKGTAKGKFTIPAGIRCGNREVTLKNANSTSATTYTAQGRKKTAQDIIIRTRVTVNLVDPLAQSFQYDENRTISSLGLYFASKGDKQSNVVIQIRGMGDQGYPNKTIYAETVMNADDIKVSNNASAETRVYFDDPMMAEGGKEYAIVIITENSDYTMWVGTRTKPKIDKPNEVISGNPYLQGVLFSSSNASTWTPHQNSDLKFGIYTSKFNETATIEFEPIKDVSADRIVLMSTYLTPERTGCTWEMKLILDDMASSTTFDQLKWEPIGNYQDLDVLGLARQVKLRATFESNRYISPLMSSSDLTFTTFLTELTGSYVGRAIDMTEAPYNTVRFSYEAFLPKGTKVVPKYSADDGKTWKTFTKSPTTTRANNEFTRYVIDEKVKSSGTNTKLQVRLDLSTENSFLRPRVRRLMVTTRDE

Entity 6 Entity 6 polymer

Description description	ORF56
Molecular weight formula_weight	91364.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MRRIRRPKVRIEIVTDDNTFTLRFEDTRDYNGDEFGAKLLGFQTKNSMEDDSSVFQINMAGDTYWDKLVMANDIIRIFITPNDDPNDKEGKQERLIQVGMVSQVSKVGSYGNDQTQFRITGQSFVKPFMKFGLGVIQEVQAVLPEVGWLIDGDGDNEVKFTGSSAHEVMTGIIRRFIPYMKYNYTEKTYNTIDNYLDYDDLSSWDEFEKLTEVSAFTNFDGSLKQLMDMVTARPFNELFFKNSEKTPGKAQLVLRKTPFNPTEWRALDMIKVPTEDFIEEDVGKSDVETYSIFTATPAGMLKELNGDVFSKPQFHPELTDRYGYTKFEVENIYLSTKSGSATEDSDSSGDDNGTERGTYSKIMKDLSNYGRDNISKGIDKYTSKLSSKYKNLKKAQAKKIIEKFVKEGKVTEKEYEKITGNKVDDELTSDNRPKLTKDKLKSILKEKFKTQDDFNNSKKKKKAKTDALKELTTKYRFGNKTHATTLLDEYIKYKGEPPNDEAFDKYLKAIEGVSNVATDTGSDASDSPLVMFSRMLFNWYHGNPNFYAGDIIVLGDPKYDLGKRLFIEDKQRGDTWEFYIESVEHKFDYKQGYYTTVGVTRGLKDAILEDGKGSPHRFAGLWNQSSDFMGGLMGEDTSKELKEKGVAEKQSSGDKDGGSDSGGAQDGGSLDSLKKYNGKLPKHDPSFVQPGNRHYKYQCTWYAYNRRGQLGIPVPLWGDAADWIGGAKGAGYGVGRTPKQGACVIWQRGVQGGSPQYGHVAFVEKVLDGGKKIFISEHNYATPNGYGTRTIDMSSAIGKNAQFIYDKK

Entity 7 Entity 7 polymer

Description description	ORF68
Molecular weight formula_weight	50474.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S,T,U

MALNFTTITENNVIRDLTTQVNNIGEELTKERNIFDITDDLVYNFNKSQKIKLTDDKGLTKSYGNITALRDIKEPGYYYIGARTLATLLDRPDMESLDVVLHVVPLDTSSKVVQHLYTLSTNNNQIKMLYRFVSGNSSSEWQFIQGLPSNKNAVISGTNILDIASPGVYFVMGMTGGMPSGVSSGFLDLSVDANDNRLARLTDAETGKEYTSIKKPTGTYTAWKKEFEPKDMEKYLLSSIRDDGSASFPLLVYTSDSKTFQQAIIDHIDRTGQTTFTFYVQGGVSGSPMSNSCRGLFMSDTPNTSSLHGVYNAIGTDGRNVTGSVVGSNWTSPKTSPSHKELWTGAQSFLSTGTTKNLSDDISNYSYVEVYTTHKTTEKTKGNDNTGTICHKFYLDGSGTYVCSGTFVSGDRTDTKPPITEFYRVGVSFKGSTWTLVDSAVQNSKTQYVTRIIGINMP

Entity 8 Entity 8 polymer

Description description	ORF63
Molecular weight formula_weight	116389.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	b

MANFLKNLHPLLRRDRNKKDNQDPNFALIDALNEEMNQVEKDAIESKLQSSLKTSTSEYLDKFGDWFGVYRKTDEKDDVYRARIIKYLLLKRGTNNAIIDAIKDYLGRDDIDVSVYEPFTNIFYTNKSHLNGEDHLMGYYYRFAVINVSIGDYFPVEIIDVINEFKPAGVTLYVTYDGASTIRGGAIIKWLDGLPKIETYQEFDRFTGYDDTFYGHINMNQSKDTDNSSSDIFKTNHSLINSLDVLTGSSSVGRQYINYGYVTSYVYNPGMTSSVNQISASTEGRGQEVPTDYYMYTSTKNNNTVELSMQTTSGVSYLYNNFNFRDYMSKYRPQVDLQSDEARRIVSDYIKELSIDYYLSAVIPPDESIEIKLQVYDFSINRWLTVSINNLSFYEKNIGSNIGYIKDYLNSELNMFTRLEINAGKRDSVDIKVNYLDLMFYYYERGIYTIKPYKALIENYLDISRETYVEAFKIASLSNGDIITKTGFQPIGYLKLVGNYENTIPSTINIVAKDTDNNPIESNELDVYNTVENRNLLQSYKGVNTIAREITSTKEFTVSGWAKEIYSTNYLSKVLKPGKVYTLSFDMEITGNDPTLKSYSDNHGIYLYSNTKGIVVNGVKSMERTIGNKVSVTQTFTAPTITDHRLLIYTGRYTSDGKASTPPVFFNTVKITELKLTEGSSKLEYSPAPEDKPNVIEKGIKFNNILTNIQTLSINSDTILKNVTLYYSYYGDSWVELKTLGNISTGETTETNNLIDLYGLQTVDYSNINPMSKVSLRSIWNVKLGELNNQEGSLSNMPNDYFNAVWQDIDKLSDIELGSMRMVKDTEGGVFDGATGEIIKATLFNVGAYTDLDMLAYTLTNYTEPLTLGSSRLISELKEELLTSESFNVDNRIKVIDSIYEELPNTSIIKNGFVEREVTGSKYLDYGLYEPIEDGTRYKLIVEGEFKDNIEFISLYNSNPNFNETFIYPSEIINGVAEKEFIAKPSTEDKPRLNTDVRIYIRPYDSTISKVRRVELRKV

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	5.60 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	22031

Phage 812 baseplate in the pre-contraction state - lower arm

1. Protein Identity and Related Structures Protein Identity & Related Structures

CBM-cenC domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF64

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF57

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF67

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF65

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF56

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF68

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

ORF63

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9tif__assembly_1__model_1

9tif__assembly_1__model_1 | I(q)

9tif__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer