← Back to search

9ua8

structure of PTP-MEG2 and IFG1R-pY1165/pY1166 peptide complex

Method: X-RAY DIFFRACTION D_max: 120.7 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9ua8
deposition_date	2025-03-31
last_revision	2026-04-08
title	structure of PTP-MEG2 and IFG1R-pY1165/pY1166 peptide complex
keywords	Complex., HYDROLASE; HYDROLASE
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	36.33 Å
rg_electron	35.72 Å
i0	288656000.00
molecular_weight	135620.0 kDa
excluded_volume	168710 Å³
envelope_volume	209220 Å³
shell_volume	49042 Å³
envelope_diameter	129.1 Å
shell_rg	41.64 Å
envelope_rg	35.37 Å
shape_rg	35.73 Å
total_rg	36.06 Å
total_atoms	9541
n_residues	1195
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	120.7 Å
rg_real	36.26 Å
rg_real_error	1.05 Å
i0_real	2.8870e+08
i0_real_error	4.7260e+06
rg_reciprocal	36.30 Å
i0_reciprocal	288700000.0000
total_estimate	0.8785
solution_quality	GOOD a GOOD solution
n_peaks	1
r_peak_primary	49.4 Å
skewness	0.259
kurtosis	-0.291
angular_range	— – 0.2200 Å⁻¹
current_alpha	0.0000
highest_alpha	83150000.0000
n_real_points	45
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.841; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.995; Smooth: 0.897

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Tyrosine-protein phosphatase non-receptor type 9
formula_weight	35110.8 kDa
ec_number	3.1.3.48
src_method	man
entity_count	4

Polymer

type	polypeptide(L)
strand_id	A,B,D,G
atom_count	9805

SVHVPGPHAMTIQELVDYVNARQKQGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEKDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMV

Source

organism	Homo sapiens
common_name	human
ncbi_taxonomy_id	9606
host_organism	Escherichia coli

Entity 2 polymer

description	THR-ASP-PTR-PTR-ARG
formula_weight	1006.9 kDa
src_method	syn
entity_count	4

Polymer

type	polypeptide(L)
strand_id	F,C,E,H

TDYYRK

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	220

▶

6. Citations (1)

▶

length_a	74.294 Å
length_b	84.707 Å
length_c	52.675 Å
angle_alpha	86.03 °
angle_beta	94.16 °
angle_gamma	90.05 °
z_pdb	4

space_group	P 1
int_tables_number	1
crystal_system	—

resolution	1.999 Å
resolution_low	36.770 Å
r_factor	0.2186
r_work	0.2167
r_free	0.2540

fit	/app/data/saxs_computation/ua/9ua8/9ua8.fit
pddf	/app/data/pr_computation/ua/9ua8/9ua8.pr.out
profile	/app/data/saxs_computation/ua/9ua8/9ua8.dat

structure of PTP-MEG2 and IFG1R-pY1165/pY1166 peptide complex

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Entity 3 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)