← Back to search

9uat

The structure of mCAT1 in complex with its substrate ornithine and the RBD of FrMLV.

Method: ELECTRON MICROSCOPY D_max: 111.3 Å Quality: GOOD

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	9uat
deposition_date	2025-04-01
title	The structure of mCAT1 in complex with its substrate ornithine and the RBD of FrMLV.
keywords	receptor, complex, MEMBRANE PROTEIN; MEMBRANE PROTEIN
method	ELECTRON MICROSCOPY

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	32.83 Å
rg_electron	32.57 Å
i0	98559900.00
molecular_weight	83327.0 kDa
excluded_volume	106140 Å³
envelope_volume	138380 Å³
shell_volume	36501 Å³
envelope_diameter	117.9 Å
shell_rg	38.07 Å
envelope_rg	32.55 Å
shape_rg	32.62 Å
total_rg	32.89 Å
total_atoms	5865
n_residues	752
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	111.3 Å
rg_real	33.01 Å
rg_real_error	1.00 Å
i0_real	9.8560e+07
i0_real_error	1.3240e+06
rg_reciprocal	32.94 Å
i0_reciprocal	98550000.0000
total_estimate	0.8661
solution_quality	GOOD a GOOD solution
n_peaks	2
r_peak_primary	32.5 Å
skewness	0.432
kurtosis	-0.386
angular_range	— – 0.2400 Å⁻¹
current_alpha	0.0000
highest_alpha	17030000.0000
n_real_points	49
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.832; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.888; Smooth: 0.869

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (6)

Entity 1 polymer

description	High affinity cationic amino acid transporter 1
formula_weight	64978.2 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	A
atom_count	5865

MGCKNLLGLGQQMLRRKVVDCSREESRLSRCLNTYDLVALGVGSTLGAGVYVLAGAVARENAGPAIVISFLIAALASVLAGLCYGEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYIIGTSSVARAWSATFDELIGKPIGEFSRQHMALNAPGVLAQTPDIFAVIIIIILTGLLTLGVKESAMVNKIFTCINVLVLCFIVVSGFVKGSIKNWQLTEKNFSCNNNDTNVKYGEGGFMPFGFSGVLSGAATCFYAFVGFDCIATTGEEVKNPQKAIPVGIVASLLICFIAYFGVSAALTLMMPYFCLDIDSPLPGAFKHQGWEEAKYAVAIGSLCALSTSLLGSMFPMPRVIYAMAEDGLLFKFLAKINNRTKTPVIATVTSGAIAAVMAFLFELKDLVDLMSIGTLLAYSLVAACVLVLRYQPEQPNLVYQMARTTEELDRVDQNELVSASESQTGFLPVAEKFSLKSILSPKNVEPSKFSGLIVNISAGLLAALIITVCIVAVLGREALAEGTLWAVFVMTGSVLLCMLVTGIIWRQPESKTKLSFKVPFVPVLPVLSIFVNIYLMMQLDQGTWVRFAVWMLIGFTIYFGYGIWHS

Source

organism	Mus musculus
common_name	house mouse
ncbi_taxonomy_id	10090
host_organism	Homo sapiens

Entity 2 polymer

description	Surface protein
formula_weight	25411.3 kDa
src_method	man
entity_count	1

Polymer

type	polypeptide(L)
strand_id	B

APGSSPHQVYNITWEVTNGDRETVWAISGNHPLWTWWPVLTPDLCMLALSGPPHWGLEYQAPYSSPPGPPCCSGSSGSSAGCSRDCDEPLTSLTPRCNTAWNRLKLDQVTHKSSEGFYVCPGSHRPREAKSCGGPDSFYCASWGCETTGRVYWKPSSSWDYITVDNNLTTSQAVQVCKDNKWCNPLAIQFTNAGKQVTSWTTGHYWGLRLYVSGRDPGLTFGIRLRYQN

Source

organism	Friend murine leukemia virus (ISOLATE 57)
ncbi_taxonomy_id	11796
host_organism	Homo sapiens

Entity 3 branched

description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	424.4 kDa
src_method	syn
entity_count	2

Entity 4 branched

description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	586.5 kDa
src_method	syn
entity_count	1

Entity 5 non-polymer

description	L-ornithine
formula_weight	132.2 kDa
src_method	man
entity_count	1

Entity 6 non-polymer

description	2-acetamido-2-deoxy-beta-D-glucopyranose
formula_weight	221.2 kDa
src_method	syn
entity_count	1

▶

6. Citations (1)

▶

length_a	1.000 Å
length_b	1.000 Å
length_c	1.000 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	90.00 °
z_pdb	—

space_group	P 1
int_tables_number	1
crystal_system	—

resolution	3.65 Å
resolution_method	—
num_particles	106963

fit	/app/data/saxs_computation/ua/9uat/9uat.fit
pddf	/app/data/pr_computation/ua/9uat/9uat.pr.out
profile	/app/data/saxs_computation/ua/9uat/9uat.dat

The structure of mCAT1 in complex with its substrate ornithine and the RBD of FrMLV.

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

EM 3D

5. Entities & Polymer Info (6)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 branched

Entity 4 branched

Entity 5 non-polymer

Entity 6 non-polymer

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)