SAXSdb — 9ubc

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

GCN5-related N-acetyltransferase

Actinosynnema mirum DSM 43827

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	Albusnodin family lasso peptide × 1 （A0A7W7W6P0） ACETYL COENZYME *A × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	C6WJ45_ACTMD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–196； UniProt 1–196

Albusnodin family lasso peptide

Actinosynnema mirum DSM 43827

UniProt A0A7W7W6P0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 2	GCN5-related N-acetyltransferase × 1 （C6WJ45） ACETYL COENZYME *A × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A7W7W6P0_9ACTN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–15； UniProt 32–46

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ubc
Deposition date deposition_date	2025-04-02
Structure title title	Sub-particle structure of the iterative acetyltransferase from Actinomycetes in complex with AcCoA and monoacetylated lasso peptides
Keywords keywords	GCN5-related N-acetyltransferases, Actinomycetes, AcCoA, Lasso peptides, TRANSFERASE; TRANSFERASE
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9ubc__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9ubc__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9ubc__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	17.86 Å
Rg (electron density)	16.59 Å
Total Rg	17.59 Å
Atom count	1649
Residues	203
Excluded volume	28644 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9ubc__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	GCN5-related N-acetyltransferase
Molecular weight formula_weight	21676.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1649

MSPQDDLIVWLRGDRAGLGPFSADLVDQYWRWEQDPSVLIGYGRQTPDSLENRREGYGHQARGTDDQLRFTVYDLTGQDPVPVGTTAVLIDHHVRTGEFVIQLGAGHRGRGLGTEATRLTLDYAFHVSALACVHLAVLTPNTGAIAAYERAGFRRIGERRDSGFWLGRRVSETLMDAVPEDFPGPSVVRGFVEGGR

Source Source

Source organism organism	Actinosynnema mirum DSM 43827
NCBI taxonomy ID ncbi_taxonomy_id	446462
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	Albusnodin family lasso peptide
Molecular weight formula_weight	1681.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

GQGKGSAEDKRRAYN

Source Source

Source organism organism	Actinosynnema mirum DSM 43827
NCBI taxonomy ID ncbi_taxonomy_id	446462
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 non-polymer

Description description	ACETYL COENZYME *A
Molecular weight formula_weight	809.6 kDa
Source method src_method	syn
Copy count entity_count	1

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.430 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	3.43 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	78368

Sub-particle structure of the iterative acetyltransferase from Actinomycetes in complex with AcCoA and monoacetylated lasso peptides

1. Protein Identity and Related Structures Protein Identity & Related Structures

GCN5-related N-acetyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

Albusnodin family lasso peptide

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ubc__assembly_1__model_1

9ubc__assembly_1__model_1 | I(q)

9ubc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)

Sub-particle structure of the iterative acetyltransferase from Actinomycetes in complex with AcCoA and monoacetylated lasso peptides

1. Protein Identity and Related Structures Protein Identity & Related Structures

GCN5-related N-acetyltransferase

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Albusnodin family lasso peptide

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

9ubc__assembly_1__model_1

9ubc__assembly_1__model_1 | I(q)

9ubc__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

7. Citations (1)