9ubx

The atomic coordinates of the mouse CatSper trimer

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cation channel sperm-associated protein 1

Mus musculus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 42 其他Polymer 30	Cation channel sperm-associated protein 2 × 3 （A2ARP9） Cation channel sperm-associated protein 3 × 3 （Q80W99） Cation channel sperm-associated protein 4 × 3 （Q8BVN3） Cation channel sperm-associated auxiliary subunit beta × 3 （A2RTF1） Cation channel sperm-associated auxiliary subunit gamma 2 × 3 （C6KI89） Cation channel sperm-associated auxiliary subunit delta × 3 （E9Q9F6） Cation channel sperm-associated auxiliary subunit epsilon × 3 （P0DP43） EF-hand calcium-binding domain-containing protein 9 × 3 （Q9DAM2） Cation channel sperm-associated auxiliary subunit TMEM249 × 3 （A0A2R8VHF7） Cation channel sperm-associated auxiliary subunit zeta × 3 （Q9CQP8） Solute carrier organic anion transporter family member 6C1 × 3 （Q8C0X7） Cation channel sperm-associated auxiliary subunit TMEM262 × 3 （D3Z338） Unknown protein × 3 ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 15 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 27 CHOLESTEROL × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSR1_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–251； UniProt 337–587 Author chain a； PDBConstruct 1–251； UniProt 337–587 Author chain n； PDBConstruct 1–251； UniProt 337–587

Cation channel sperm-associated protein 2

Mus musculus

UniProt A2ARP9

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 42 其他Polymer 30	Cation channel sperm-associated protein 1 × 3 （Q91ZR5） Cation channel sperm-associated protein 3 × 3 （Q80W99） Cation channel sperm-associated protein 4 × 3 （Q8BVN3） Cation channel sperm-associated auxiliary subunit beta × 3 （A2RTF1） Cation channel sperm-associated auxiliary subunit gamma 2 × 3 （C6KI89） Cation channel sperm-associated auxiliary subunit delta × 3 （E9Q9F6） Cation channel sperm-associated auxiliary subunit epsilon × 3 （P0DP43） EF-hand calcium-binding domain-containing protein 9 × 3 （Q9DAM2） Cation channel sperm-associated auxiliary subunit TMEM249 × 3 （A0A2R8VHF7） Cation channel sperm-associated auxiliary subunit zeta × 3 （Q9CQP8） Solute carrier organic anion transporter family member 6C1 × 3 （Q8C0X7） Cation channel sperm-associated auxiliary subunit TMEM262 × 3 （D3Z338） Unknown protein × 3 ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 15 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 27 CHOLESTEROL × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSR2_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–281； UniProt 94–374 Author chain b； PDBConstruct 1–281； UniProt 94–374 Author chain o； PDBConstruct 1–281； UniProt 94–374

Cation channel sperm-associated protein 3

Mus musculus

UniProt Q80W99

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 42 其他Polymer 30	Cation channel sperm-associated protein 1 × 3 （Q91ZR5） Cation channel sperm-associated protein 2 × 3 （A2ARP9） Cation channel sperm-associated protein 4 × 3 （Q8BVN3） Cation channel sperm-associated auxiliary subunit beta × 3 （A2RTF1） Cation channel sperm-associated auxiliary subunit gamma 2 × 3 （C6KI89） Cation channel sperm-associated auxiliary subunit delta × 3 （E9Q9F6） Cation channel sperm-associated auxiliary subunit epsilon × 3 （P0DP43） EF-hand calcium-binding domain-containing protein 9 × 3 （Q9DAM2） Cation channel sperm-associated auxiliary subunit TMEM249 × 3 （A0A2R8VHF7） Cation channel sperm-associated auxiliary subunit zeta × 3 （Q9CQP8） Solute carrier organic anion transporter family member 6C1 × 3 （Q8C0X7） Cation channel sperm-associated auxiliary subunit TMEM262 × 3 （D3Z338） Unknown protein × 3 ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 15 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 27 CHOLESTEROL × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSR3_MOUSE
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–278； UniProt 38–315 Author chain c； PDBConstruct 1–278； UniProt 38–315 Author chain p； PDBConstruct 1–278； UniProt 38–315

Cation channel sperm-associated protein 4

Mus musculus

UniProt Q8BVN3

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 42 其他Polymer 30	Cation channel sperm-associated protein 1 × 3 （Q91ZR5） Cation channel sperm-associated protein 2 × 3 （A2ARP9） Cation channel sperm-associated protein 3 × 3 （Q80W99） Cation channel sperm-associated auxiliary subunit beta × 3 （A2RTF1） Cation channel sperm-associated auxiliary subunit gamma 2 × 3 （C6KI89） Cation channel sperm-associated auxiliary subunit delta × 3 （E9Q9F6） Cation channel sperm-associated auxiliary subunit epsilon × 3 （P0DP43） EF-hand calcium-binding domain-containing protein 9 × 3 （Q9DAM2） Cation channel sperm-associated auxiliary subunit TMEM249 × 3 （A0A2R8VHF7） Cation channel sperm-associated auxiliary subunit zeta × 3 （Q9CQP8） Solute carrier organic anion transporter family member 6C1 × 3 （Q8C0X7） Cation channel sperm-associated auxiliary subunit TMEM262 × 3 （D3Z338） Unknown protein × 3 ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 15 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 27 CHOLESTEROL × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSR4_MOUSE
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–250； UniProt 42–291 Author chain d； PDBConstruct 1–250； UniProt 42–291 Author chain q； PDBConstruct 1–250； UniProt 42–291

Cation channel sperm-associated auxiliary subunit beta

Mus musculus

UniProt A2RTF1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 42 其他Polymer 30	Cation channel sperm-associated protein 1 × 3 （Q91ZR5） Cation channel sperm-associated protein 2 × 3 （A2ARP9） Cation channel sperm-associated protein 3 × 3 （Q80W99） Cation channel sperm-associated protein 4 × 3 （Q8BVN3） Cation channel sperm-associated auxiliary subunit gamma 2 × 3 （C6KI89） Cation channel sperm-associated auxiliary subunit delta × 3 （E9Q9F6） Cation channel sperm-associated auxiliary subunit epsilon × 3 （P0DP43） EF-hand calcium-binding domain-containing protein 9 × 3 （Q9DAM2） Cation channel sperm-associated auxiliary subunit TMEM249 × 3 （A0A2R8VHF7） Cation channel sperm-associated auxiliary subunit zeta × 3 （Q9CQP8） Solute carrier organic anion transporter family member 6C1 × 3 （Q8C0X7） Cation channel sperm-associated auxiliary subunit TMEM262 × 3 （D3Z338） Unknown protein × 3 ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 15 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 27 CHOLESTEROL × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSRB_MOUSE
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–1065； UniProt 22–1086 Author chain e； PDBConstruct 1–1065； UniProt 22–1086 Author chain r； PDBConstruct 1–1065； UniProt 22–1086

Cation channel sperm-associated auxiliary subunit gamma 2

Mus musculus

UniProt C6KI89

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 42 其他Polymer 30	Cation channel sperm-associated protein 1 × 3 （Q91ZR5） Cation channel sperm-associated protein 2 × 3 （A2ARP9） Cation channel sperm-associated protein 3 × 3 （Q80W99） Cation channel sperm-associated protein 4 × 3 （Q8BVN3） Cation channel sperm-associated auxiliary subunit beta × 3 （A2RTF1） Cation channel sperm-associated auxiliary subunit delta × 3 （E9Q9F6） Cation channel sperm-associated auxiliary subunit epsilon × 3 （P0DP43） EF-hand calcium-binding domain-containing protein 9 × 3 （Q9DAM2） Cation channel sperm-associated auxiliary subunit TMEM249 × 3 （A0A2R8VHF7） Cation channel sperm-associated auxiliary subunit zeta × 3 （Q9CQP8） Solute carrier organic anion transporter family member 6C1 × 3 （Q8C0X7） Cation channel sperm-associated auxiliary subunit TMEM262 × 3 （D3Z338） Unknown protein × 3 ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 15 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 27 CHOLESTEROL × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSG2_MOUSE
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–1042； UniProt 44–1085 Author chain f； PDBConstruct 1–1042； UniProt 44–1085 Author chain s； PDBConstruct 1–1042； UniProt 44–1085

Cation channel sperm-associated auxiliary subunit delta

Mus musculus

UniProt E9Q9F6

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 42 其他Polymer 30	Cation channel sperm-associated protein 1 × 3 （Q91ZR5） Cation channel sperm-associated protein 2 × 3 （A2ARP9） Cation channel sperm-associated protein 3 × 3 （Q80W99） Cation channel sperm-associated protein 4 × 3 （Q8BVN3） Cation channel sperm-associated auxiliary subunit beta × 3 （A2RTF1） Cation channel sperm-associated auxiliary subunit gamma 2 × 3 （C6KI89） Cation channel sperm-associated auxiliary subunit epsilon × 3 （P0DP43） EF-hand calcium-binding domain-containing protein 9 × 3 （Q9DAM2） Cation channel sperm-associated auxiliary subunit TMEM249 × 3 （A0A2R8VHF7） Cation channel sperm-associated auxiliary subunit zeta × 3 （Q9CQP8） Solute carrier organic anion transporter family member 6C1 × 3 （Q8C0X7） Cation channel sperm-associated auxiliary subunit TMEM262 × 3 （D3Z338） Unknown protein × 3 ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 15 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 27 CHOLESTEROL × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSRD_MOUSE
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–733； UniProt 17–749 Author chain g； PDBConstruct 1–733； UniProt 17–749 Author chain t； PDBConstruct 1–733； UniProt 17–749

Cation channel sperm-associated auxiliary subunit epsilon

Mus musculus

UniProt P0DP43

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 42 其他Polymer 30	Cation channel sperm-associated protein 1 × 3 （Q91ZR5） Cation channel sperm-associated protein 2 × 3 （A2ARP9） Cation channel sperm-associated protein 3 × 3 （Q80W99） Cation channel sperm-associated protein 4 × 3 （Q8BVN3） Cation channel sperm-associated auxiliary subunit beta × 3 （A2RTF1） Cation channel sperm-associated auxiliary subunit gamma 2 × 3 （C6KI89） Cation channel sperm-associated auxiliary subunit delta × 3 （E9Q9F6） EF-hand calcium-binding domain-containing protein 9 × 3 （Q9DAM2） Cation channel sperm-associated auxiliary subunit TMEM249 × 3 （A0A2R8VHF7） Cation channel sperm-associated auxiliary subunit zeta × 3 （Q9CQP8） Solute carrier organic anion transporter family member 6C1 × 3 （Q8C0X7） Cation channel sperm-associated auxiliary subunit TMEM262 × 3 （D3Z338） Unknown protein × 3 ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 15 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 27 CHOLESTEROL × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSRE_MOUSE
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–921； UniProt 50–970 Author chain h； PDBConstruct 1–921； UniProt 50–970 Author chain u； PDBConstruct 1–921； UniProt 50–970

EF-hand calcium-binding domain-containing protein 9

Mus musculus

UniProt Q9DAM2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 42 其他Polymer 30	Cation channel sperm-associated protein 1 × 3 （Q91ZR5） Cation channel sperm-associated protein 2 × 3 （A2ARP9） Cation channel sperm-associated protein 3 × 3 （Q80W99） Cation channel sperm-associated protein 4 × 3 （Q8BVN3） Cation channel sperm-associated auxiliary subunit beta × 3 （A2RTF1） Cation channel sperm-associated auxiliary subunit gamma 2 × 3 （C6KI89） Cation channel sperm-associated auxiliary subunit delta × 3 （E9Q9F6） Cation channel sperm-associated auxiliary subunit epsilon × 3 （P0DP43） Cation channel sperm-associated auxiliary subunit TMEM249 × 3 （A0A2R8VHF7） Cation channel sperm-associated auxiliary subunit zeta × 3 （Q9CQP8） Solute carrier organic anion transporter family member 6C1 × 3 （Q8C0X7） Cation channel sperm-associated auxiliary subunit TMEM262 × 3 （D3Z338） Unknown protein × 3 ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 15 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 27 CHOLESTEROL × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	EFCB9_MOUSE
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–174； UniProt 1–174 Author chain Q； PDBConstruct 1–174； UniProt 1–174 Author chain i； PDBConstruct 1–174； UniProt 1–174

Cation channel sperm-associated auxiliary subunit TMEM249

Mus musculus

UniProt A0A2R8VHF7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 42 其他Polymer 30	Cation channel sperm-associated protein 1 × 3 （Q91ZR5） Cation channel sperm-associated protein 2 × 3 （A2ARP9） Cation channel sperm-associated protein 3 × 3 （Q80W99） Cation channel sperm-associated protein 4 × 3 （Q8BVN3） Cation channel sperm-associated auxiliary subunit beta × 3 （A2RTF1） Cation channel sperm-associated auxiliary subunit gamma 2 × 3 （C6KI89） Cation channel sperm-associated auxiliary subunit delta × 3 （E9Q9F6） Cation channel sperm-associated auxiliary subunit epsilon × 3 （P0DP43） EF-hand calcium-binding domain-containing protein 9 × 3 （Q9DAM2） Cation channel sperm-associated auxiliary subunit zeta × 3 （Q9CQP8） Solute carrier organic anion transporter family member 6C1 × 3 （Q8C0X7） Cation channel sperm-associated auxiliary subunit TMEM262 × 3 （D3Z338） Unknown protein × 3 ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 15 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 27 CHOLESTEROL × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TM249_MOUSE
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 24–168； UniProt 1–145 Author chain j； PDBConstruct 24–168； UniProt 1–145 Author chain w； PDBConstruct 24–168； UniProt 1–145

Cation channel sperm-associated auxiliary subunit zeta

Mus musculus

UniProt Q9CQP8

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 42 其他Polymer 30	Cation channel sperm-associated protein 1 × 3 （Q91ZR5） Cation channel sperm-associated protein 2 × 3 （A2ARP9） Cation channel sperm-associated protein 3 × 3 （Q80W99） Cation channel sperm-associated protein 4 × 3 （Q8BVN3） Cation channel sperm-associated auxiliary subunit beta × 3 （A2RTF1） Cation channel sperm-associated auxiliary subunit gamma 2 × 3 （C6KI89） Cation channel sperm-associated auxiliary subunit delta × 3 （E9Q9F6） Cation channel sperm-associated auxiliary subunit epsilon × 3 （P0DP43） EF-hand calcium-binding domain-containing protein 9 × 3 （Q9DAM2） Cation channel sperm-associated auxiliary subunit TMEM249 × 3 （A0A2R8VHF7） Solute carrier organic anion transporter family member 6C1 × 3 （Q8C0X7） Cation channel sperm-associated auxiliary subunit TMEM262 × 3 （D3Z338） Unknown protein × 3 ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 15 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 27 CHOLESTEROL × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CTSRZ_MOUSE
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–149； UniProt 38–186 Author chain k； PDBConstruct 1–149； UniProt 38–186 Author chain x； PDBConstruct 1–149； UniProt 38–186

Solute carrier organic anion transporter family member 6C1

Mus musculus

UniProt Q8C0X7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 42 其他Polymer 30	Cation channel sperm-associated protein 1 × 3 （Q91ZR5） Cation channel sperm-associated protein 2 × 3 （A2ARP9） Cation channel sperm-associated protein 3 × 3 （Q80W99） Cation channel sperm-associated protein 4 × 3 （Q8BVN3） Cation channel sperm-associated auxiliary subunit beta × 3 （A2RTF1） Cation channel sperm-associated auxiliary subunit gamma 2 × 3 （C6KI89） Cation channel sperm-associated auxiliary subunit delta × 3 （E9Q9F6） Cation channel sperm-associated auxiliary subunit epsilon × 3 （P0DP43） EF-hand calcium-binding domain-containing protein 9 × 3 （Q9DAM2） Cation channel sperm-associated auxiliary subunit TMEM249 × 3 （A0A2R8VHF7） Cation channel sperm-associated auxiliary subunit zeta × 3 （Q9CQP8） Cation channel sperm-associated auxiliary subunit TMEM262 × 3 （D3Z338） Unknown protein × 3 ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 15 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 27 CHOLESTEROL × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SO6C1_MOUSE
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–610； UniProt 81–690 Author chain l； PDBConstruct 1–610； UniProt 81–690 Author chain y； PDBConstruct 1–610； UniProt 81–690

Cation channel sperm-associated auxiliary subunit TMEM262

Mus musculus

UniProt D3Z338

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Other combination	Heteromer	Protein 42 其他Polymer 30	Cation channel sperm-associated protein 1 × 3 （Q91ZR5） Cation channel sperm-associated protein 2 × 3 （A2ARP9） Cation channel sperm-associated protein 3 × 3 （Q80W99） Cation channel sperm-associated protein 4 × 3 （Q8BVN3） Cation channel sperm-associated auxiliary subunit beta × 3 （A2RTF1） Cation channel sperm-associated auxiliary subunit gamma 2 × 3 （C6KI89） Cation channel sperm-associated auxiliary subunit delta × 3 （E9Q9F6） Cation channel sperm-associated auxiliary subunit epsilon × 3 （P0DP43） EF-hand calcium-binding domain-containing protein 9 × 3 （Q9DAM2） Cation channel sperm-associated auxiliary subunit TMEM249 × 3 （A0A2R8VHF7） Cation channel sperm-associated auxiliary subunit zeta × 3 （Q9CQP8） Solute carrier organic anion transporter family member 6C1 × 3 （Q8C0X7） Unknown protein × 3 ;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 15 2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose × 6 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 ;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ; × 3 2-acetamido-2-deoxy-beta-D-glucopyranose × 27 CHOLESTEROL × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	TM262_MOUSE
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–115； UniProt 1–115 Author chain m； PDBConstruct 1–115； UniProt 1–115 Author chain z； PDBConstruct 1–115； UniProt 1–115

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9ubx
Deposition date deposition_date	2025-04-03
Structure title title	The atomic coordinates of the mouse CatSper trimer
Keywords keywords	sperm, hyperactivation, calcium channel, PROTEIN TRANSPORT; PROTEIN TRANSPORT
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

9ubx__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

9ubx__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

9ubx__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	120.20 Å
Total Rg	120.10 Å
Atom count	144816
Residues	18063
Excluded volume	2609200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`9ubx__assembly_1__model_1`	42-meric （42）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (21)

Entity 1 Entity 1 polymer

Description description	Cation channel sperm-associated protein 1
Molecular weight formula_weight	29080.7 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,n,a
Atom count atom_count	144816

LLGLQQMILSLTQSLGFETFIFIVVCLNTVILVAQTFTELEIRGEWYFMVLDSIFLSIYVLEAVLKLIALGLEYFYDPWNNLDFFIMVMAVLDFVLLQINSLSYSFYNHSLFRILKVFKSMRALRAIRVLRRLSILTSLHEVAGTLSGSLPSITAILTLMFTCLFLFSVVLRALFQDSDPKRFQNIFTTLFTLFTMLTLDDWSLIYIDNRAQGAWYIIPILMIYIVIQYFIFLNLVIAVLVDNFQMALLKG

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Mus musculus

Entity 2 Entity 2 polymer

Description description	Cation channel sperm-associated protein 2
Molecular weight formula_weight	33115.5 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,o,b

PLSLWAGWVLDSSVFSKFIISLIFLNTFVLMVEIELMESTNTALWPVKLALEVADWFILLSFIVEILLMWLASFSLFWKDAWNVFDFFVTLLSLLPELVVLLGVPAHSVWLQLLRVCRVLRSLKLFARFRQIKVILLALVRALKSMTFLLMLLLIFFYIFAVTGVYFFREYSRSTIEGLEYNMFFSDLLNSLVTVFILFTLDHWYAVLQDIWKVPESSRVFSSIYVILWLLLGSIIFRNIIVAMMVTNFQNIRSELSEEMSHLEVQYKADMFKQQIIQRRQ

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Mus musculus

Entity 3 Entity 3 polymer

Description description	Cation channel sperm-associated protein 3
Molecular weight formula_weight	32308.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,p,c

ECQAYFRKVIKSTFFQIVMITTVTTNSFLLVLGTNYDIQFEFFRTFEVSELFFVSVYVCEFLMKVYVDPITYWKDGYNILDVIILIILTIPYLLRKIKGNHSAYLHFADGIQSLRILKLISYSRGIRTLIIAVGETVYTVASVLTLLFLLMFVFAILGFCLFGVTDRGDLENWGNLASAFFTLFSLATVDGWTDLQEELDKRKFTVSRAFTILFILLASFIFLNMFVGVMIMHTEDSMKKFERDLTLERNLAIMEEKQIILKRQQEEVNRLMNTQKSG

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Mus musculus

Entity 4 Entity 4 polymer

Description description	Cation channel sperm-associated protein 4
Molecular weight formula_weight	28880.4 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,q,d

DVMEKKDAWDVQEFITQMYIKQLLRHPAFQLLLAFLLLSNAITIALRTNSYLGQKHYELFSTIDDIVLTILICEVLLGWLNGFWIFWKDGWNILNFAIVFILFMGFFIKQLDMVAITYPLRVLRLVHVCMAVEPLARIIKVILQSMPDLANVMALILFFMLVFSVFGVTLFGAFVPKHFQNMGVALYTLFICITQDGWLDIYTDFQMDEREYAMEVGGAIYFAVFITLGAFIGLNLFVVVVTTNLEQMMK

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Mus musculus

Entity 5 Entity 5 polymer

Description description	Cation channel sperm-associated auxiliary subunit beta
Molecular weight formula_weight	121580.6 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,r,e

VIHNKGKERTYFSCSGEGILTGLHTIKLFLTMDNLKVRCFFRNENQSPSKEILGLFTSGGLAPNMIITNSTFYGGYYFKLTPFSNRLEWLIDIPRQNITVNTDIAAVEQWMIKITMHEGLNIYDTEGTLLDLVREPILQWNLGRVLTEMEVRDLYPEVNDIKVTKSPCANDVALIGFMMKPSSNGVFIGKTISGFWTYKECIWHDLTEIIYAELKDEHQGLTVIDLVLTNHFLVILTSLGLYVSSDLRYPTTSQIKLSRAEFCGFERVDYIRGNLWYNEKCFANRESFEVDYVTITFNRNRTLSESSSCFFSKEPFLHWLPCVFSTIKNEKSIPRVITFLIDQETDSGIYLFNVQDTKETYVTVAMLKDGKPSPRPKFPSFHFPSTFTLPLGMIFHPRSHFLYVYGSQIWVSMDGGNTFEMLCNLFSHHVTKTSNSFYTSDIVFIVEDGRILTTKAGLTTYSELGILKDAIFTLYYDQLGYIHKLTPENFDAGSKLLGHGNSGSIFGKRPDLGFEAILVPQYISTNEMYFFAHVPLTMPTNIQWKKRFKTIHLGKTIEFSKTGLANIKNVYMHKTEPVGFQTSIHTEIIVPFGIENSKDSPCLLSDLEITYSGKLYYTIKLLSKNPLHELKSTDVEKSVLIPGYSSFLIMNITDKWTASALATMPQAIKSNLKFLTGSWFLYNFGTAGGRKWSISTRQCNYWIQQDSLDFMSLNLVKYIDVGNTIDFQFKIIPKAMSTFPIPPVSMVVGNPGLVEVKTQGVFDLNENYYLDIHVSGRFFQKGSTSIALVLWEGSSKCYAITLLPTIKSSCSYLRTMHHTPGRHIPPEDWISGVHKDSQGFNMIKTLPINYRPPSHMGISIPLTDNFYHADPSKPIPRNQFHKSKETGKYKQCANVTSRAMCNCSEHQKFSHAVAFSDCKEKVHRFKFPVTQYPVVLEIFNERDKISAEPPYLVTMTEVNMRKNWQLKHNEPENVKKMKHYLEPLLKTPVYNPLGLNLTIQGSELFHFKVSVVPGVSFCELSEEFQIYVDEVPLPFPGHALIAVATSVVLGVLIFIAFVFQLRNIH

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Mus musculus

Entity 6 Entity 6 polymer

Description description	Cation channel sperm-associated auxiliary subunit gamma 2
Molecular weight formula_weight	119864.4 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,f,s

HCTWLLVLNKFEKVGLHLSKDRFQDHEPIDTVAKVFQKLTDSPIDPSENYLSFPYYLQINFSCPGQNIEELARKGHLMGMKPMVQINYMYSVNFYRWEMENVQILMEAAPMRSTGYCPAEAMCVLNWYTPMPFKNGSVVSSVDIYTNGIGPFVSKKRFYVNMNGFLKRDASGKSLFAIGYESLVLKSSHFRLSKSRPLWYTVNHAPVFILGGFYDEKSILFSDSNFQDYVLLELSIDSCWVGSFYCPILGFSATIHDAIATESTLFIRQNQLVYYFTGTYITLFDKSHGSSRWVRVLPSECIKRLCPVYASGNGSEYVLALTTGKNEGYIHIGTITDGLVSFEMVPDGWSVCEKLPGKNCSIDWATYIADERNLLLLVKIDSGQFYLVNFNTEFKTLNILYKIPEFIPEAKELDFLVLLDTVTYTNTPMTPKGLFFNTLNNMLYIWGNFILQSYNREEFIFLADFPKESTIKYMVNSFKGQMAVVTENEEIWYFLEGGYDVYQVVPSQGWETYHNLQKMQKSSFHSEDESLVSLFFEDGKLFQLVYLFDVGKERLVKRLLPVGTLMEYNLPKPFTVVNQGNYQAISFTHTCPFKEIHLIDVPKKHHASRTESYVALPPLVSESLGFHNNNTLAVYQGLVYYLLWLHSKYDKPYADPVHDPTWRWWQHKTKDKDYFFYLFSNRLAAEGIYINMNAYQKLYNMSGDYGIPDLFFLDKGNWFTITVVLLSHQDTFTSSDSQGPTINVDKKLAIAVTIADPECLSVTVTQDVLLNRNAVINKIKVIDKKRCSEQGMIGRNIKKTSMMLKVLGAPGNCIQRTYLGGIIQGFKVVPIFIGCPPGKRLAFDVSYTIMHSEEINKHYFDCVIKDAEMPCFLFRDLFQPFFLVQDLVTGDSGSFLGSYVLKVVGGGRTLNTIRDYTEEEIFRYNSPLDTTNSLIWKTKVERTTEDKKFYIMSHESPGVEWLCLENSPCYDIIPQSIYPPEFFFKLLVSNRGVDNSTYCDYKLTFIVHIHGLPLSSKRTSFIVMVSTSFFIALVVFYILFCL

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Mus musculus

Entity 7 Entity 7 polymer

Description description	Cation channel sperm-associated auxiliary subunit delta
Molecular weight formula_weight	82834.3 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,t,g

HTLCRVHTVRTGKVFKSNIQLQGDPLFYAFPNTFVLKNVCKADISVYLGQKVFLTIDNFESSLLPLTVPKSLAVGVPSITSAHFVSGSLVLFVISGKGYSYDYYENTWRKLEGISEPVSHISGDVCCFKGSFCLELSNNLFAYLRGGQIPGTNIYFSDNGGFSFQLMNTDKLSHLTGTLGGIFHLHSMSQVGVLMVENNLGTFHYMEYPLNHSMGIAFSYKNLLEVIMKPYQRGFMVLWNQKSILVSSNSGQIVEHVRLIDQKIFTDLDVEHANINIYSVASNAYELAFLVAEDHLYYGSQSYMGTYVIKLPHQPLWSTHTSIYFEDIGILQVLTPVADPHFAAYDFDKCTVNVQSSLMDEKLALQPCNVELLESTMINTMFTIDMNSKLKLSALMIPRKGENPTPLVMVSNPHALGFKANLNEFGNTFDGNSKYKLDIELKQQHHWGNSDFNFTASIKRHAISSVTVDIADKTLSCVDLKPLSTLISVGCDMTKKIVVQNKISACTMGILNPVQLQKNYTYTIEKEAYDPINHNGEAQDDLIVFYEYKDLGCPRLVYYDKPWKPVVELWKNGIVEEIMNAEYVISEINGLVTYSYSLTAATANCRSQPQNWSTFESDIENEEPFLWNRENYVSCHEDNKDNPLLWPNVEYQVLGGQTNNKIIFGQRNGIYTFHLSVVDPYYSYCNLNTIFSVYVHGALPVTKFQPLLTILLMVTTTLLTAWLAYAIPKQLRS

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Mus musculus

Entity 8 Entity 8 polymer

Description description	Cation channel sperm-associated auxiliary subunit epsilon
Molecular weight formula_weight	107004.0 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,u,h

LWRYYINSQDYSIFSTRSSIKLEYEGNSFVSWKIPESCKVENTTSPKTTLHCKRAGIHTIKPIAGNQEVERHLTVDNSYICYLWYFTVVDVYYNLSQIVTIWVYDPESASTEELIWTAKKPSLSSRVLTKQMNTLGQRPFIFTVEKRLTYHPGPLTSEGTWVIHLPMSSDDIAKVIRGNKVAFQDCFIANLYFMLTYPMTIISEPPGYEPLTVPPGSPLMLSWDTCISTFALLATDQETFQTNDSFQTWTRVRAPPGILSDAQRHSLRDVIIFDQGTLFLVDGTVYLRTEDEFTKLDESRGISETGILGFSKRRWCQIRYLYKLASKKSILIAWSKTTVYAGYATFRFVTLTDTAKLKDFLKLPQTDTLEVMSVEYLWHPLEAAVLLSHCSVCTTNTRNIRIVIYSAIFQTWTLQDFELQLPKEAILEFRFLYSAMPDIIMWDQHHVYYSYKNFTVVGTISTPSGETNLSSLSQGSKIHQVLTDRIGNVVVKMENNVMFYIKADITEAVILHTWVNTTAKTVVLFDKSFEVCILYYNENLDEKYQLQTQPYPLILELQSINKDLGDWCPYLAFQHNIHSQFYHMDKGESLTIWSQIVYPENRGLYIVVEHYGSSVMTWTQNLEYEIASGFCTKTMITRFFQTTNYELVDNYYQLQKENTGLMLLQFRPSEFSRTCLTAKPVFEIDVGCDSSKYIMVRGFNKSRCQRRDFSYVIDKELLRESLSDNLKVRYDVAKYGCPLTLELGQMFQPIVELYDENGFIKIVDANFILWEIHGRNDYTFNSTMEQNGCINEAQTWDSMIEENPDIPLDDVWGPQNYRPCFSYAIGKPGDLGQPYEILNYSNKNHIKWPMTYAGMYVYRLKILDPNYSFCNLTTIFAIESLGMIPRSSVYLVAALIFVLMLTFISILVLSYFWYLKIYRQF

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Mus musculus

Entity 9 Entity 9 polymer

Description description	EF-hand calcium-binding domain-containing protein 9
Molecular weight formula_weight	20942.3 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,i,Q

MKLTPGCFLWYLYMDKIYCLLSLRNVKALMVYFHLLDVHHRNTLNDVLFFHFLQHVTNLNKSQIGMIFDLLDWTAVGEIGFDQFYVLICILLAHQDHLEDHFMYRHSRPVFELLDLDGEMNIGAANFQNYRFLFNIKKQELRDLFHDFDITGDRLLNYKEFKLYTIFCTDKSID

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Mus musculus

Entity 10 Entity 10 polymer

Description description	Cation channel sperm-associated auxiliary subunit TMEM249
Molecular weight formula_weight	19898.6 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,w,j

MCWVMPPSVFVLEYYLDTLWKGTMLFIICLVFISCNVLREVKYQETWCFPAYGMVIGLWLMLSSIPQRRLVLNHTRGMYHFSIQGRTVCQGPMHLVYVRLALSSDAYGGRFFQLVLCGHKLEPLVLVQLSERYEQMEFLGRHLARKLNINYFDYLASSYRHVVRHWPL

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Mus musculus

Entity 11 Entity 11 polymer

Description description	Cation channel sperm-associated auxiliary subunit zeta
Molecular weight formula_weight	17504.6 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,x,k

TANVSVSDVCEDFDEEGKSVRNRIRKYSQTISIRDSLNLEPEEIQQQARRELELCHGRSLEHGEDHEESETSLASSTSESLIFSLWKPHRTYWTEQQNRLPLPLMELMETEVLDILKKALITYRSTIGRNHFMTKELQGYIEGIRKRRN

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Mus musculus

Entity 12 Entity 12 polymer

Description description	Solute carrier organic anion transporter family member 6C1
Molecular weight formula_weight	68349.7 kDa
Mutation mutation	A224G
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,y,l

PIVLPFVQRFNNIDGFMTLYVAAVLIHGALFAVVDMTLNIYQVQFSLTRTEWYLMDFSDYIASFVVAIIIAHFGSKGNRTRWIAASCILMGLESMLFAFPFFTYEIIIPGRQSIELCMEENEKRNIICGNSVPNRSKCIYFHIGGQCIHGIAGMPIYILGITFIFDHIPTSSCGFYLAIGHSAYLIGYLLGMVGGLQNFQPPPKEKTVEIEPAKVYQLLQSGWWKTFLIIAAISFCVSFMMVCFPTSLPGAHKLRLAKRKEPPTIDRRLKDMKIQPHLKGFLHNIWHILKNPLMLTQAICKVSEYLTFNTSLYFLPHHLQTQFLITPGIASLLTGAFVLPGGIIGHFLGGLIVDRLEMTNKNKLKFTLVTTVVSVGLFLLIFFVECQTTTFAGINEDYDGYGQLGNLTADCNEYCDCTTSLYTSICGRDEKEYFSPCFAGCKATKVSQTEKTYYNCSCIKEGLAASDDEGQFIDAIAGTCDSDCLKLPLFFAFYFSATVFSNMCSIPVISIILQSVPANFTSLSLGVTYAIVKFVASVPAPLLFRLSSAIACIYWDNNRCGGKERCWIYNKNILVYEFMGIWMSSQLIIVLLNIYAIQIHDVVVHGEITE

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Mus musculus

Entity 13 Entity 13 polymer

Description description	Cation channel sperm-associated auxiliary subunit TMEM262
Molecular weight formula_weight	13350.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,z,m

MRWRDRIAVLCFPPGLMLTVAALILFFIHMGVFASDVHNFCVIHNYDHMSFRYTVVLIFSQVISIGWAAMGSLYAEMTGDKFLRCFALTILILNGAMFFNRLCLEFLAINYREER

Source Source

Source organism organism	Mus musculus
Common name common_name	house mouse
NCBI taxonomy ID ncbi_taxonomy_id	10090
Host organism host_organism	Mus musculus

Entity 14 Entity 14 polymer

Description description	Unknown protein
Molecular weight formula_weight	2401.0 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N,P,O

XXXXXXXXXXXXXXXXXXXXXXXXXXXX

Entity 15 Entity 15 branched

Description description	;beta-D-mannopyranose-(1-2)-beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-3)-beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	1235.1 kDa
Source method src_method	man
Copy count entity_count	3

Entity 16 Entity 16 branched

Description description	beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	586.5 kDa
Source method src_method	man
Copy count entity_count	15

Entity 17 Entity 17 branched

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	424.4 kDa
Source method src_method	man
Copy count entity_count	6

Entity 18 Entity 18 branched

Description description	;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-6)-[beta-D-mannopyranose-(1-3)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	1235.1 kDa
Source method src_method	man
Copy count entity_count	3

Entity 19 Entity 19 branched

Description description	;beta-D-mannopyranose-(1-3)-[beta-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose ;
Molecular weight formula_weight	910.8 kDa
Source method src_method	man
Copy count entity_count	3

Entity 20 Entity 20 non-polymer

Description description	2-acetamido-2-deoxy-beta-D-glucopyranose
Molecular weight formula_weight	221.2 kDa
Source method src_method	man
Copy count entity_count	27

Entity 21 Entity 21 non-polymer

Description description	CHOLESTEROL
Molecular weight formula_weight	386.7 kDa
Source method src_method	syn
Copy count entity_count	3

▶

Resolution resolution	6.80 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	69708

The atomic coordinates of the mouse CatSper trimer

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cation channel sperm-associated protein 1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cation channel sperm-associated protein 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cation channel sperm-associated protein 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cation channel sperm-associated protein 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cation channel sperm-associated auxiliary subunit beta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cation channel sperm-associated auxiliary subunit gamma 2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cation channel sperm-associated auxiliary subunit delta

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cation channel sperm-associated auxiliary subunit epsilon

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

EF-hand calcium-binding domain-containing protein 9

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cation channel sperm-associated auxiliary subunit TMEM249

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer